DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and nphs1

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_031761552.1 Gene:nphs1 / 100494620 XenbaseID:XB-GENE-487811 Length:1236 Species:Xenopus tropicalis


Alignment Length:1141 Identity:237/1141 - (20%)
Similarity:348/1141 - (30%) Gaps:416/1141 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEEGDFSL 146
            |.|.::|.:.|.|.||...|.|.|....|.:||.|:...||..||:.||.||||.|...:|:::|
 Frog    24 QVFRVQPDNITVVQGSTALLSCEVEHGTGMVQWEKNGLLLGPDRNIPGFLRYSMTGDPHKGEYNL 88

  Fly   147 DIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ---GDYLVTTEDREIELE 208
            .|....|||||:|.||||.. :...||.||.|.:.||:||:||...:   |..:......|..:.
 Frog    89 RIERSELDDDAEYHCQVGRS-EVSLGIISRTALINVLIPPKAPTFEEYAAGSRVTWVYGVEYTVT 152

  Fly   209 CVSQGGKPAAEITWIDGLGNVLTKGIEY----VKEPLADSRRITARSILKLAPKKEHHNTTFTCQ 269
            |.:...||||.:|       :...|:|.    ...|.:..:......:.|:.|:...:....||.
 Frog   153 CQATDAKPAAALT-------IKKSGLEVSGDSSSNPGSRDKLENTAMVAKVIPQSSDNGKLLTCL 210

  Fly   270 AQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSC-QADANPHELSYRWFIN 333
            |.|.|.:|..:....:.|.:.|.  ..::.|.: |..:..|..:.|.| ....|| ..:.:|..|
 Frog   211 ALNPALQTPITVSFTMNVLFPPN--APIIEGYI-GPSVKAGETLKLICISLSGNP-LATLQWSKN 271

  Fly   334 DELMTGDFTTKMIIH--------NVSRQYHDAIVKCEVVNAV----------------------- 367
            |::::..:.|..::.        |:....:.|:|.||.||.|                       
 Frog   272 DDVVSTRWETDEVVRASRSHLTLNIKPADNMAVVSCEAVNHVTPETLKTSIILNVVFLPTEVTIL 336

  Fly   368 GKSEQSKKLDISF-----------------GP--------------------------------- 382
            |.|...:|.:::|                 ||                                 
 Frog   337 GSSSGPEKSNLTFSCFTAASNPPVQIRWWLGPKELVNTIVTISDAVHGGKVTMSNLTMEALREEH 401

  Fly   383 -------VFRQ------------------RPVSVEAD-------LGATVSMRC-DVAGNPEPEIE 414
                   .|.:                  :.|.:||.       .|.:|.|.| ...|||.|.:.
 Frog   402 GMALTCEAFNEAILYTKSNSVTLSVQYPPQNVWIEAPPADKFFRAGTSVKMTCFSSGGNPPPRLT 466

  Fly   415 WISENSDQVVG--------VAAELK-LKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITS 470
            ||.:......|        |..|:. :.|.|:....|.|.|     ..||        :.|.:|:
 Frog   467 WIKDTKSLSGGSQIHSGKIVTKEITIITVPSDNMATYRCNA-----SNIG--------KTPALTA 518

  Fly   471 H---KVQFGGV-------------GGRVKIDCLAFSIPKAEHILWSFEGK--------------- 504
            .   ||||..:             |..:.:.|:..|...|..|.|..:|:               
 Frog   519 STKLKVQFPAIDVNIISSAKEYRRGSTIILTCVTGSSNPASTISWVKDGEQLKAQDLGRKPSLYG 583

  Fly   505 --------IINMSSAD------------------------------------PDIYIFEEHH--- 522
                    .:..:|.|                                    |.:....||.   
 Frog   584 GISSSSRVTLKAASKDNGRRVSCEAFSSVLNEAVNTFYKLNILFPPEFLDDQPAVVQAVEHGAAL 648

  Fly   523 LPEGVRA-------------ALIIRDSKATHF-----------------GKYNCTVMNSYGGDSL 557
            :|..|||             ..:|||....|.                 |.||.|.:|..|.:|:
 Frog   649 IPVRVRANPPQINYTWSLWGEKLIRDGAYRHHLRGEGALEIWNVSRADSGVYNVTCVNKEGKNSI 713

  Fly   558 VITL-------LREPGNIPVLLVVMGSMFCVAIILMIVMIIIVYRKRRSRKKPMPA-----D--- 607
            ||.|       :|..|:..|.|.....:.|.|........:..:|.....::.:.|     |   
 Frog   714 VIRLDVQYSPTIRSLGDTEVDLGSDAEIACTADANPATDSMFQWRWLGDEERDLSALERKVDGVI 778

  Fly   608 ---VIPEASRGGDKLNE----------LKSELR---------SKAYDVEYSEAGGDG---LAINL 647
               ||.||.|......|          :|::.|         .|...:......|||   .|:..
 Frog   779 GRLVIREAKRTDAGRYECTVDNGIPPSIKADARLIVRFKPDIHKGVHLSKVAVPGDGKSVAALVC 843

  Fly   648 TQSPMPDVQMKGATLGVPLAGPVKFDERFSGDFGGDRYNRQ------CHIKNLKNQQETAYKGSP 706
            ....:|.|....|..||.|            |....||:.:      .|...|.....:|.|   
 Frog   844 KAEGIPSVAFSWAKNGVSL------------DLKDPRYSEKTFHELSVHTSTLVISNVSAVK--- 893

  Fly   707 QANGYAHYFEYAL-------------------DYSPPGGEGAAVVVGSGGVGKLKNGGMNSATLP 752
                     :|||                   ..|.|.......|:|.         ..||.||.
 Frog   894 ---------DYALFTCTATNTLGVDSFTIQLVSTSRPDPPSGLRVIGF---------THNSVTLQ 940

  Fly   753 HSAAATVNGGGAGNGGGAS--------LPRNQRH---EIQQSQQS----NGFLGQPLLQ---NGI 799
            .|         ||..|||.        .|....|   ::...|::    .|..|.....   |.|
 Frog   941 WS---------AGFDGGAEQKFRVRYRWPGTDSHMYVDVFPPQETVFTITGLKGSTAYNFSVNAI 996

  Fly   800 DSRFSAIYGNP----YLRTNSSLLPPLPPPSTANPAATPAP-----PPYHAARHGHAHHANGGLK 855
            ::...:.|.:.    .:.|..:.|.|:|   |..|...|..     |||..|            .
 Frog   997 NALGESDYADQGAVVSVTTKETTLLPVP---TQQPTRAPTAEALEWPPYILA------------A 1046

  Fly   856 HFVGGAVITTSPVGNVNINGGGGGGSTPSGGGGVGV 891
            ...|||::.   |.|....|.....|.....||.||
 Frog  1047 VCAGGALLL---VSNAAFIGCLVKRSRDKSQGGEGV 1079

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 41/95 (43%)
IG_like 88..182 CDD:214653 41/93 (44%)
C2-set_2 189..279 CDD:285423 20/96 (21%)
Ig_2 307..379 CDD:290606 20/103 (19%)
I-set 382..462 CDD:254352 25/154 (16%)
IGc2 396..446 CDD:197706 17/59 (29%)
Ig 466..561 CDD:299845 35/202 (17%)
IG_like 478..561 CDD:214653 29/187 (16%)
nphs1XP_031761552.1 Ig 25..105 CDD:416386 34/79 (43%)
Ig strand A 25..28 CDD:409353 1/2 (50%)
Ig strand A' 32..35 CDD:409353 0/2 (0%)
Ig strand B 41..51 CDD:409353 3/9 (33%)
Ig strand C 53..58 CDD:409353 2/4 (50%)
Ig strand C' 60..62 CDD:409353 0/1 (0%)
Ig strand D 82..86 CDD:409353 1/3 (33%)
Ig strand F 99..108 CDD:409353 6/8 (75%)
Ig strand G 113..123 CDD:409353 5/9 (56%)
Ig 138..228 CDD:416386 19/96 (20%)
Ig strand A' 139..143 CDD:409353 0/3 (0%)
Ig strand B 150..157 CDD:409353 1/6 (17%)
Ig strand C 162..167 CDD:409353 2/11 (18%)
Ig strand C' 170..172 CDD:409353 1/1 (100%)
Ig strand D 175..182 CDD:409353 0/6 (0%)
Ig strand E 188..196 CDD:409353 0/7 (0%)
Ig strand F 205..213 CDD:409353 3/7 (43%)
Ig strand G 219..225 CDD:409353 0/5 (0%)
Ig 229..326 CDD:416386 20/100 (20%)
Ig strand A 229..232 CDD:409353 0/2 (0%)
Ig strand A' 235..239 CDD:409353 0/3 (0%)
Ig strand B 249..259 CDD:409353 2/9 (22%)
Ig strand C 262..271 CDD:409353 2/9 (22%)
Ig strand D 273..280 CDD:409353 0/6 (0%)
Ig strand E 285..295 CDD:409353 0/9 (0%)
Ig strand F 303..312 CDD:409353 5/8 (63%)
Ig strand G 318..325 CDD:409353 0/6 (0%)
Ig 332..413 CDD:416386 7/80 (9%)
Ig strand A' 333..337 CDD:409353 0/3 (0%)
Ig strand B 345..355 CDD:409353 1/9 (11%)
Ig strand C 358..367 CDD:409353 0/8 (0%)
Ig strand C' 368..371 CDD:409353 1/2 (50%)
Ig strand D 374..381 CDD:409353 0/6 (0%)
Ig strand E 386..395 CDD:409353 0/8 (0%)
Ig strand F 403..411 CDD:409353 0/7 (0%)
Ig_3 429..509 CDD:404760 21/84 (25%)
Ig strand B 449..458 CDD:409353 3/8 (38%)
Ig strand C 464..469 CDD:409353 1/4 (25%)
Ig strand C' 472..474 CDD:409353 0/1 (0%)
Ig strand D 483..486 CDD:409353 0/2 (0%)
Ig strand F 502..509 CDD:409353 3/11 (27%)
Ig strand G 514..524 CDD:409353 2/9 (22%)
Ig 541..618 CDD:416386 9/76 (12%)
Ig strand B 544..554 CDD:409353 1/9 (11%)
Ig strand C 557..566 CDD:409353 3/8 (38%)
Ig strand C' 567..570 CDD:409353 1/2 (50%)
Ig strand D 572..579 CDD:409353 0/6 (0%)
Ig strand E 584..594 CDD:409353 0/9 (0%)
Ig strand F 602..614 CDD:409353 0/11 (0%)
Ig <652..719 CDD:416386 17/66 (26%)
Ig strand C 659..667 CDD:409353 0/7 (0%)
Ig strand C' 668..671 CDD:409353 0/2 (0%)
Ig strand D 677..683 CDD:409353 1/5 (20%)
Ig strand E 686..694 CDD:409353 0/7 (0%)
Ig strand F 698..706 CDD:409353 4/7 (57%)
Ig strand G 708..719 CDD:409353 5/10 (50%)
Ig_3 723..800 CDD:404760 15/76 (20%)
Ig strand B 739..743 CDD:409353 0/3 (0%)
Ig strand C 752..758 CDD:409353 0/5 (0%)
Ig strand E 779..783 CDD:409353 0/3 (0%)
Ig strand F 793..798 CDD:409353 1/4 (25%)
Ig strand G 807..810 CDD:409353 1/2 (50%)
Ig 814..922 CDD:416386 22/131 (17%)
putative Ig strand A 819..824 CDD:409353 1/4 (25%)
putative Ig strand B 839..846 CDD:409353 1/6 (17%)
putative Ig strand C 850..856 CDD:409353 1/5 (20%)
putative Ig strand C' 859..861 CDD:409353 1/1 (100%)
putative Ig strand D 868..871 CDD:409353 2/2 (100%)
putative Ig strand E 878..886 CDD:409353 2/7 (29%)
putative Ig strand F 897..904 CDD:409353 1/6 (17%)
putative Ig strand G 919..922 CDD:409353 1/2 (50%)
FN3 921..1015 CDD:238020 21/111 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.