DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and PAPLN

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:503 Identity:88/503 - (17%)
Similarity:139/503 - (27%) Gaps:220/503 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TSYQNQRFAMEPQDQTAVVGARVTLPCR-VINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDE 86
            :||:.....:||....|.:|..|.|.|. ....:....|.||...:.:.|....|          
Human   905 SSYRISLAGVEPSLVQAALGQLVRLSCSDDTAPESQAAWQKDGQPISSDRHRLQF---------- 959

  Fly    87 EGDYSLDIYPVMLDDDARYQC-QVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRK 150
              |.||.|:|:..:|...|.| ...||.:.|                                 |
Human   960 --DGSLIIHPLQAEDAGTYSCGSTRPGRDSQ---------------------------------K 989

  Fly   151 VEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQ 215
            :::..  :||..|           ||:: .|.:..|.|..                         
Human   990 IQLRI--IGGDMA-----------VLSE-AELSRFPQPRD------------------------- 1015

  Fly   216 AQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGG-GSVHMSTGSRIVEHSQVRL 279
                                            |....|..|.||. |::..|       |.|...
Human  1016 --------------------------------PAQDFGQAGAAGPLGAIPSS-------HPQPAN 1041

  Fly   280 ECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISY 344
            ..|.|.|                                                          
Human  1042 RLRLDQN---------------------------------------------------------- 1048

  Fly   345 APSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVW------IQHPSDRVVGTSTNLTFSVSNETA 403
                  :|:.::|..|..:.:||..:..|.|.|.|      :..|..::....:.:...|:.|..
Human  1049 ------QPRVVDASPGQRIRMTCRAEGFPPPAIEWQRDGQPVSSPRHQLQPDGSLVISRVAVEDG 1107

  Fly   404 GRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGL-------VGDTARIECFASSVPRARHV 461
            |.|.|   |....:.....:|.|:    :..:.|..||       .|||||:.|..:.  .:.::
Human  1108 GFYTC---VAFNGQDRDQRWVQLR----VLGELTISGLPPTVTVPEGDTARLLCVVAG--ESVNI 1163

  Fly   462 SWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCT 509
            .|:.||..:.:: ||    .|...|.|   ||:|.:.:|...|.|.|:
Human  1164 RWSRNGLPVQAD-GH----RVHQSPDG---TLLIYNLRARDEGSYTCS 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 22/97 (23%)
Ig 42..114 CDD:299845 19/73 (26%)
C2-set_2 135..225 CDD:285423 9/89 (10%)
Ig_3 265..329 CDD:290638 6/63 (10%)
I-set 346..420 CDD:254352 16/79 (20%)
Ig 360..425 CDD:299845 14/70 (20%)
Ig5_KIRREL3-like 428..524 CDD:143235 24/89 (27%)
IG_like 435..524 CDD:214653 24/82 (29%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767 88/503 (17%)
Ig 914..>978 CDD:325142 19/75 (25%)
I-set 1049..1119 CDD:254352 16/72 (22%)
IG 1139..1219 CDD:214652 21/75 (28%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.