DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and CG34353

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:657 Identity:120/657 - (18%)
Similarity:193/657 - (29%) Gaps:258/657 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPD 189
            |.|:::|.|.          |..|..|              :.|..|:..:...:::.|    ||
  Fly   100 GETIVLPCEV----------ANTDTYV--------------VAWKRGIAILTAGSVKVT----PD 136

  Fly   190 QR-RFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGG 253
            .| |......|::.........::.||   .|....|.....||:...|::.             
  Fly   137 PRVRLVNGFNLQIRDALPTDAGDYICQ---IATMDPREITHTVEILVPPRIH------------- 185

  Fly   254 SVGGAGGGSVHMSTGS--RIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTR 316
                      |:|||.  ::.:.|.||:||.|..||.           |.:...:...::.|...
  Fly   186 ----------HISTGGHLQVKKGSSVRIECSATGNPM-----------PNVTWSRKNNILPNGEE 229

  Fly   317 KFHDAIVK-------------CEVQNSVGKSEDSE-TLDISYAPSFR-QRPQSMEADVGSVVSLT 366
            |.|..::.             |...|.||:...|: .|.:.::|... :||.....: |...:|.
  Fly   230 KLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGE-GHEATLV 293

  Fly   367 CEVDSNPQPEIVWI----------QHPSDRVVGTSTNLTFSVSNETAGRYYCKA-NVPGYA---- 416
            |.|....|||::|.          :|..:......|.:...|..:..|.|.|.| |..|.|    
  Fly   294 CIVHGETQPEVIWFKDTMQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTL 358

  Fly   417 EISADAYVYLKGSPAIGSQRTQYGL---VGDTARIECFASS---VPRARHVSWTFNGQEISSESG 475
            ::|....|.:..||.|...:.:|.:   |...:.||.:..|   :|:...|.    |..|.|.|.
  Fly   359 QLSGKPNVAVFNSPPISQYKDRYNISWAVDSHSPIEEYKLSFRKLPQGHEVV----GNAIDSSSS 419

  Fly   476 HDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGIS 540
                          .|::....||.|..|                                    
  Fly   420 --------------SSSMSSSSSQMYGSG------------------------------------ 434

  Fly   541 VVAFLLVLTILVVVYIKCKKRTKLPPADVISEHQITKN-GGVSCKLEPGDRTSNYSDLKVDISGG 604
                                         :..|:|..| ||:|               .:..||.
  Fly   435 -----------------------------LHAHRIGSNMGGLS---------------GLSGSGS 455

  Fly   605 YVPYGD------------------YSTHYSPPPQYLTT-CSTKSNGSSTIMQNNHQNQLQLQQQQ 650
            |..||:                  .|.||:....|:.. .....:..:|:               
  Fly   456 YSGYGNVIHWGHNDWRNVVLPAVPVSHHYAQGMSYMVRGLDPDQHYEATV--------------- 505

  Fly   651 QQSHHQHHTQTTTLPMTFLTNSSGG------------------SLTGSIIGSREI-RQDNGLPSL 696
             ||.:::.....|....|.|:|:.|                  .|:.:..||..| ||..||.:|
  Fly   506 -QSRNRYGWSDLTNSFVFSTSSNDGPVDLSTFLNHGLSDNEMRDLSVTFYGSSAINRQKLGLLAL 569

  Fly   697 QSTTASV 703
            .|.|.::
  Fly   570 SSATLAL 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 2/4 (50%)
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423 14/90 (16%)
Ig_3 265..329 CDD:290638 16/78 (21%)
I-set 346..420 CDD:254352 21/89 (24%)
Ig 360..425 CDD:299845 19/79 (24%)
Ig5_KIRREL3-like 428..524 CDD:143235 19/101 (19%)
IG_like 435..524 CDD:214653 16/94 (17%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 21/110 (19%)
Ig 103..177 CDD:143165 17/104 (16%)
IG_like 191..269 CDD:214653 18/88 (20%)
IGc2 198..258 CDD:197706 14/70 (20%)
I-set 273..360 CDD:254352 21/87 (24%)
Ig 290..359 CDD:143165 17/68 (25%)
FN3 <466..524 CDD:238020 9/73 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.