DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and aebp1b

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:148 Identity:33/148 - (22%)
Similarity:54/148 - (36%) Gaps:49/148 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 QHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDT 445
            ||..||.| ||......|.           .:|.||.|.                      ||..
Zfish    42 QHVEDRNV-TSVEDLLQVK-----------IIPPYATIE----------------------VGQH 72

  Fly   446 ARIECFASSVPRARHVSWTF-NGQEISSESG----HDYSILVDAVPGGVKSTLIIRDSQAYHYGK 505
            .::.|..||  .|::::|.. ||:::.::.|    |::        |.|.|:|.:.::...:.|.
Zfish    73 KQLLCKVSS--DAKNINWVSPNGEKVLTKHGNLKVHNH--------GSVLSSLTVLNANLNNAGI 127

  Fly   506 YNCTVVNDYGNDVAEIQL 523
            |.|...|......|.::|
Zfish   128 YKCVATNGDTESQATVKL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638
I-set 346..420 CDD:254352 12/38 (32%)
Ig 360..425 CDD:299845 12/43 (28%)
Ig5_KIRREL3-like 428..524 CDD:143235 21/101 (21%)
IG_like 435..524 CDD:214653 21/94 (22%)
aebp1bXP_696022.6 Ig 56..147 CDD:299845 26/133 (20%)
IG_like 62..145 CDD:214653 24/114 (21%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.