DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and tmigd1

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001091718.1 Gene:tmigd1 / 559127 ZFINID:ZDB-GENE-080303-6 Length:251 Species:Danio rerio


Alignment Length:199 Identity:44/199 - (22%)
Similarity:85/199 - (42%) Gaps:29/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 SVHMSTGSRI---VEHSQVRLECRAD-ANPSDVR-YRWFIN-------DEPIIGGQKTEMVIRNV 314
            |..::.||.:   ||.: |.|.|..| .:||..: .:||.|       :|.::  .::.:.::.|
Zfish    27 SCPLAVGSLLQTAVEET-VTLTCMTDNTDPSSQQELQWFRNGARVKLPEENMM--SRSSLCVQPV 88

  Fly   315 TRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVW 379
            |::...|:..|:::.....:...| .|:||.|......:....:....| |:|||.:||...:||
Zfish    89 TKEDDGAVFTCQLKGDASVNSTVE-FDVSYPPDLNDTIEVFVQETNDAV-LSCEVRANPPVTVVW 151

  Fly   380 IQHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGD 444
                  :..|...:||......|......:..:|   ::..|.:   :|.....::...||:.|.
Zfish   152 ------KKDGEVLDLTTGSYKSTNNGITAQLTIP---KLKRDVH---QGLYVCETKSAMYGVTGR 204

  Fly   445 TARI 448
            |.::
Zfish   205 TFQV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 18/75 (24%)
I-set 346..420 CDD:254352 15/73 (21%)
Ig 360..425 CDD:299845 15/64 (23%)
Ig5_KIRREL3-like 428..524 CDD:143235 5/21 (24%)
IG_like 435..524 CDD:214653 4/14 (29%)
tmigd1NP_001091718.1 Ig 43..>100 CDD:299845 13/59 (22%)
IG_like 129..210 CDD:214653 20/93 (22%)
Ig 135..193 CDD:143165 16/70 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.