Sequence 1: | NP_001284835.1 | Gene: | rst / 31290 | FlyBaseID: | FBgn0003285 | Length: | 764 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001091718.1 | Gene: | tmigd1 / 559127 | ZFINID: | ZDB-GENE-080303-6 | Length: | 251 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 44/199 - (22%) |
---|---|---|---|
Similarity: | 85/199 - (42%) | Gaps: | 29/199 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 262 SVHMSTGSRI---VEHSQVRLECRAD-ANPSDVR-YRWFIN-------DEPIIGGQKTEMVIRNV 314
Fly 315 TRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVW 379
Fly 380 IQHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGD 444
Fly 445 TARI 448 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rst | NP_001284835.1 | IG_like | 34..130 | CDD:214653 | |
Ig | 42..114 | CDD:299845 | |||
C2-set_2 | 135..225 | CDD:285423 | |||
Ig_3 | 265..329 | CDD:290638 | 18/75 (24%) | ||
I-set | 346..420 | CDD:254352 | 15/73 (21%) | ||
Ig | 360..425 | CDD:299845 | 15/64 (23%) | ||
Ig5_KIRREL3-like | 428..524 | CDD:143235 | 5/21 (24%) | ||
IG_like | 435..524 | CDD:214653 | 4/14 (29%) | ||
tmigd1 | NP_001091718.1 | Ig | 43..>100 | CDD:299845 | 13/59 (22%) |
IG_like | 129..210 | CDD:214653 | 20/93 (22%) | ||
Ig | 135..193 | CDD:143165 | 16/70 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |