DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and sdk1a

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_009297968.1 Gene:sdk1a / 558391 ZFINID:ZDB-GENE-081104-374 Length:2245 Species:Danio rerio


Alignment Length:519 Identity:107/519 - (20%)
Similarity:176/519 - (33%) Gaps:183/519 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PQDQTAVVG-ARVTLPC----RVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLD 93
            |::.|.|.| :..||.|    |.:.|. :|.|.::  |:..:..:..|.|...:.:....|..:.
Zfish   329 PRNTTVVAGISEATLECVANARPVEKL-SLVWRRN--GVEVASGVGSFSRRLTIINPTSTDVGMY 390

  Fly    94 IYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKIT-------QGDVIYATEDRKV 151
            :...:|.|.:           .:||....|..:|     |||..|       .|:|     ::.|
Zfish   391 VCEALLLDSS-----------VKPAEARAFLSIT-----EAPYFTAEPRRKMMGEV-----EKSV 434

  Fly   152 EIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQA 216
            :|:| ...|.|..::.|                                                
Zfish   435 DIQC-QARGVPMPKLEW------------------------------------------------ 450

  Fly   217 QNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLEC 281
                   |:.|        .|..|:|                       :...:|:  |.:.|:.
Zfish   451 -------YKDA--------VPLSKLN-----------------------NPRYKII--SSMGLQV 475

  Fly   282 RADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDI-SYA 345
            | ...|||.                              .|.:|..:||.|:::....||: |.|
Zfish   476 R-KLQPSDA------------------------------GIFQCFARNSAGEAQVHTYLDVTSMA 509

  Fly   346 PSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVW-----------IQHPSDRVVGTSTNLTFSVS 399
            |:|...|..:....|:|.:.||.|...|:|.|||           :|.|...::.:.......|.
Zfish   510 PAFTAPPLDITVTDGAVAAFTCRVSGAPKPAIVWRRDTQILASGSVQIPRFTLLESGGLQIQPVV 574

  Fly   400 NETAGRYYC-KANVPGYAEISADAYVYLKGSPAIGSQRTQYGLV-GDTARIECFASSVPR--ARH 460
            .:..|.|.| .||..|....||...|:.:.|  |.|..|...:: |.||.:||.|:..||  .|:
Zfish   575 LQDTGNYTCYAANSEGAINASASLTVWSRTS--ISSPPTDRRVIKGTTAILECGATHDPRVGVRY 637

  Fly   461 VSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQ 524
            | |..:.:.:|...|...|:        .:.:|.|..:.:...|.|.|.|:::.||:..|.:|:
Zfish   638 V-WKKDEELVSHSRGGRISL--------QEGSLHISQTWSGDIGNYTCDVISEAGNESKEARLE 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 21/100 (21%)
Ig 42..114 CDD:299845 14/76 (18%)
C2-set_2 135..225 CDD:285423 10/96 (10%)
Ig_3 265..329 CDD:290638 9/63 (14%)
I-set 346..420 CDD:254352 22/85 (26%)
Ig 360..425 CDD:299845 21/76 (28%)
Ig5_KIRREL3-like 428..524 CDD:143235 27/98 (28%)
IG_like 435..524 CDD:214653 24/91 (26%)
sdk1aXP_009297968.1 I-set 125..208 CDD:254352
Ig 125..204 CDD:299845
IG_like 222..302 CDD:214653
Ig 236..287 CDD:299845
Ig_3 322..394 CDD:290638 15/67 (22%)
I-set 323..412 CDD:254352 20/96 (21%)
I-set 416..505 CDD:254352 28/213 (13%)
Ig 436..500 CDD:299845 22/183 (12%)
I-set 510..600 CDD:254352 24/89 (27%)
Ig 527..600 CDD:299845 19/72 (26%)
I-set 605..693 CDD:254352 28/99 (28%)
Ig 610..693 CDD:299845 25/92 (27%)
FN3 697..788 CDD:238020
fn3 800..886 CDD:278470
FN3 901..997 CDD:238020
FN3 1002..1090 CDD:238020
FN3 1100..1196 CDD:238020
FN3 1206..1301 CDD:238020
FN3 1308..1397 CDD:238020
FN3 1408..1501 CDD:238020
FN3 1507..1602 CDD:238020
FN3 1616..1722 CDD:238020
FN3 1732..1825 CDD:238020
FN3 1830..1919 CDD:238020
FN3 1931..2021 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.