| Sequence 1: | NP_001284835.1 | Gene: | rst / 31290 | FlyBaseID: | FBgn0003285 | Length: | 764 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018174.2 | Gene: | lrit1a / 553943 | ZFINID: | ZDB-GENE-040924-5 | Length: | 643 | Species: | Danio rerio |
| Alignment Length: | 206 | Identity: | 40/206 - (19%) |
|---|---|---|---|
| Similarity: | 82/206 - (39%) | Gaps: | 69/206 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 287 PSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDA--IVKCEVQNSVGKSEDSETLDISYAPSFR 349
Fly 350 QR---PQSM-------------------------EADVGSVVSLTCEVDSNPQPEIVW------- 379
Fly 380 ------IQHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQ 438
Fly 439 YGLVGDTARIE 449 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rst | NP_001284835.1 | IG_like | 34..130 | CDD:214653 | |
| Ig | 42..114 | CDD:299845 | |||
| C2-set_2 | 135..225 | CDD:285423 | |||
| Ig_3 | 265..329 | CDD:290638 | 8/43 (19%) | ||
| I-set | 346..420 | CDD:254352 | 23/114 (20%) | ||
| Ig | 360..425 | CDD:299845 | 21/77 (27%) | ||
| Ig5_KIRREL3-like | 428..524 | CDD:143235 | 2/22 (9%) | ||
| IG_like | 435..524 | CDD:214653 | 2/15 (13%) | ||
| lrit1a | NP_001018174.2 | leucine-rich repeat | 61..84 | CDD:275378 | |
| LRR_8 | 63..119 | CDD:290566 | |||
| LRR_RI | <77..175 | CDD:238064 | 1/3 (33%) | ||
| leucine-rich repeat | 85..108 | CDD:275378 | |||
| LRR_8 | 108..167 | CDD:290566 | |||
| leucine-rich repeat | 109..132 | CDD:275378 | |||
| leucine-rich repeat | 133..156 | CDD:275378 | |||
| leucine-rich repeat | 157..170 | CDD:275378 | |||
| LRRCT | 199..243 | CDD:214507 | 8/45 (18%) | ||
| I-set | 252..343 | CDD:254352 | 23/108 (21%) | ||
| Ig | 259..333 | CDD:299845 | 18/76 (24%) | ||
| fn3 | 448..515 | CDD:278470 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||