DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and NTM

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:341 Identity:74/341 - (21%)
Similarity:125/341 - (36%) Gaps:84/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAM 81
            |||...|      |.....:.|...|...||.|.:.|:...:.|......|....|....:...:
Human    31 VRSGDAT------FPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVV 89

  Fly    82 VGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYAT 146
            :.|:.:..||::|..|.:.|:..|.|.|.  .:..|  :::...|.|.|.|:..:|:..  |...
Human    90 LLSNTQTQYSIEIQNVDVYDEGPYTCSVQ--TDNHP--KTSRVHLIVQVSPKIVEISSD--ISIN 148

  Fly   147 EDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSV--------LRLTP 203
            |...:.:.|::. |:|...:||                      |..:.|:|        |.:..
Human   149 EGNNISLTCIAT-GRPEPTVTW----------------------RHISPKAVGFVSEDEYLEIQG 190

  Fly   204 KKEHHNTNFSCQAQN-TADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMST 267
            .....:.::.|.|.| .|....|  :::|.|.|.|.:      |...|.|..||..|        
Human   191 ITREQSGDYECSASNDVAAPVVR--RVKVTVNYPPYI------SEAKGTGVPVGQKG-------- 239

  Fly   268 GSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQK----------TEMVIRNVTRKFHD-A 321
                      .|:|.|.|.|| ..::|:.:|:.:|.|:|          ::::..||:.  || .
Human   240 ----------TLQCEASAVPS-AEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSE--HDYG 291

  Fly   322 IVKCEVQNSVGKSEDS 337
            ...|...|.:|.:..|
Human   292 NYTCVASNKLGHTNAS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 21/95 (22%)
Ig 42..114 CDD:299845 17/71 (24%)
C2-set_2 135..225 CDD:285423 16/98 (16%)
Ig_3 265..329 CDD:290638 16/74 (22%)
I-set 346..420 CDD:254352
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
NTMNP_001338930.1 Ig 44..132 CDD:416386 20/91 (22%)
Ig strand A' 44..49 CDD:409353 1/4 (25%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 1/3 (33%)
FR2 64..70 CDD:409353 1/5 (20%)
Ig strand C 64..70 CDD:409353 1/5 (20%)
CDR2 71..83 CDD:409353 2/11 (18%)
Ig strand C' 72..76 CDD:409353 0/3 (0%)
Ig strand C' 80..83 CDD:409353 1/2 (50%)
FR3 84..118 CDD:409353 8/33 (24%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 2/5 (40%)
Ig strand F 110..118 CDD:409353 2/7 (29%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..132 CDD:409353 2/10 (20%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 136..205 CDD:404760 15/93 (16%)
Ig strand A' 142..147 CDD:409353 1/6 (17%)
Ig strand B 153..160 CDD:409353 1/6 (17%)
Ig strand C 166..171 CDD:409353 2/26 (8%)
Ig strand D 177..180 CDD:409353 1/2 (50%)
Ig strand E 184..190 CDD:409353 1/5 (20%)
Ig strand F 197..204 CDD:409353 1/6 (17%)
Ig strand G 211..219 CDD:409353 2/9 (22%)
Ig_3 222..299 CDD:404760 23/103 (22%)
putative Ig strand A 223..229 CDD:409353 2/11 (18%)
Ig strand B 239..243 CDD:409353 2/21 (10%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 0/3 (0%)
Ig strand F 292..297 CDD:409353 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.