DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and dpr12

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:268 Identity:60/268 - (22%)
Similarity:99/268 - (36%) Gaps:48/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 GKSEDSETLDISYAPSFRQ---RPQSMEADVGSVVSLTCEVDSNPQ-----PEIVWIQHPSDRVV 388
            |.|:....||.|.:|.|..   ...:....:|....|.|:|....:     .:|.||:.....::
  Fly    61 GDSKLDNNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHIL 125

  Fly   389 GTSTNLTFS---------------------VSNETAGRYYCKANVP-GYAEISADAYVYLKGSPA 431
            .:...|..:                     |.....|.|.|:.:.| |......:..|.:..:..
  Fly   126 SSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFI 190

  Fly   432 IGSQRTQYGLVGDTARIECFASSVPR-ARHVSWTFNGQEIS-SESGHDYSILVDAVPG-GVKSTL 493
            :||......: |.|..:.|.....|. .::|.|..|.:.|: .:|..|  |.::..|| ..:|.|
  Fly   191 LGSGELHVDM-GSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRD--ITIETTPGPRTQSRL 252

  Fly   494 IIRDSQAYHYGKYNCTVVN----------DYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVL 548
            |||:.|....|.|.|:..|          ..|:::|.|..:...|...|..|..  |::|..|:|
  Fly   253 IIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFR--SMLAPCLLL 315

  Fly   549 TILVVVYI 556
            ..:||.:|
  Fly   316 NTVVVRHI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638
I-set 346..420 CDD:254352 16/103 (16%)
Ig 360..425 CDD:299845 14/91 (15%)
Ig5_KIRREL3-like 428..524 CDD:143235 28/108 (26%)
IG_like 435..524 CDD:214653 26/101 (26%)
dpr12NP_652462.3 IG 86..183 CDD:214652 14/96 (15%)
Ig_3 193..271 CDD:404760 23/80 (29%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.