DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and tutl

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:576 Identity:130/576 - (22%)
Similarity:213/576 - (36%) Gaps:112/576 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TMQLL--LLATIVGMVRSSPYTSYQNQRFAMEPQDQ---TAVVGARVTLPCRVINKQG-----TL 58
            |:|:|  :|.:::.::.       :|.:....|:|.   ||::|..|...|.|.....     .|
  Fly   107 TIQVLQFVLVSLLALLA-------KNAQAHNIPEDAVHITAILGEGVIFNCHVEFPNDHPVPYVL 164

  Fly    59 QWTKDDFGLGTSRDL------------SGFE-RYAMVGSDEE-GDYSLDIYPVMLDDDARYQCQV 109
            ||.|.....|:...:            .|:: |.:.|..|.. |..||::..:...|...|:|:|
  Fly   165 QWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKV 229

  Fly   110 ---SPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEITWIDG 171
               :..|:...  ..|:..|.|..||.. .:|..|:||......:.:.| ...|.|..||.|...
  Fly   230 VFLNRDPKQHK--NGTWFHLDVHAPPRF-SVTPEDIIYVNLGDSIILNC-QADGTPTPEILWYKD 290

  Fly   172 LGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYA 236
            ..         .|.|.|....|...:.||::..:......::|.|:|...:...:|::.:     
  Fly   291 AN---------PVDPSPTVGIFNDGTELRISTIRHEDIGEYTCIARNGEGQVSHTARVII----- 341

  Fly   237 PKVKVNVMGSLPGGAGGSVGGAGGGSVHM--STGSRIVEHSQVRLECRADANPSDVRYRWFINDE 299
                                  .||:|.|  .|....:|..:|...|.|.|.|.:|..||:....
  Fly   342 ----------------------AGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGS 384

  Fly   300 PI--IGGQKTEMVIR-------NVTRKFHDAIVKCEVQNSVGKSED-SETLDISYAP--SFRQRP 352
            |:  :...:|.:.||       |..:........|||.|.:|..:. |..|.:.|..  :|....
  Fly   385 PVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTV 449

  Fly   353 QSMEADVGSVVSLTCEVDSNPQPE-IVWIQ--------HPSDRVVGTSTNLTFS-VSNETAGRYY 407
            |.:...:..||.  |.:.|:||.: :.|.:        ...|.||..:.:|.|: |:.|..|:|.
  Fly   450 QYLPFRLAGVVQ--CYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYA 512

  Fly   408 CKA-NVPGYAEISADAYVYLKGSPAIGSQ-RTQY-GLVGDTARIECFASSVPRARH--VSWTFNG 467
            |.. |..|.|..|....|.::..||...: .|.| ..|||:..:.|.|........  :.|....
  Fly   513 CTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQE 577

  Fly   468 QEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQL 523
            .|..:||..:..    .:.||   .:.|.:.:...:|.|.|.|.|:....:|..||
  Fly   578 GEQLTESQRNRI----KISGG---NITIENLRREDFGYYQCVVSNEVATLMAVTQL 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 28/120 (23%)
Ig 42..114 CDD:299845 20/93 (22%)
C2-set_2 135..225 CDD:285423 19/89 (21%)
Ig_3 265..329 CDD:290638 19/74 (26%)
I-set 346..420 CDD:254352 22/86 (26%)
Ig 360..425 CDD:299845 21/75 (28%)
Ig5_KIRREL3-like 428..524 CDD:143235 24/100 (24%)
IG_like 435..524 CDD:214653 22/93 (24%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 25/114 (22%)
IG_like 137..229 CDD:214653 21/91 (23%)
I-set 253..341 CDD:254352 21/98 (21%)
IGc2 268..331 CDD:197706 15/72 (21%)
I-set 346..437 CDD:254352 24/90 (27%)
Ig 349..437 CDD:299845 22/87 (25%)
Ig 459..530 CDD:299845 21/72 (29%)
IG_like 549..628 CDD:214653 20/85 (24%)
IGc2 551..617 CDD:197706 16/72 (22%)
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.