DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and plum

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001163744.1 Gene:plum / 43197 FlyBaseID:FBgn0039431 Length:1298 Species:Drosophila melanogaster


Alignment Length:465 Identity:100/465 - (21%)
Similarity:160/465 - (34%) Gaps:143/465 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LQWTKDDF--------GLGTSRDLSGFERYAMVGSDEEGDYSLDI---YPVMLDDDARYQCQVSP 111
            :.:.|:||        .|.|:...|| |.|..:..||....|..|   |||:.        ::.|
  Fly   108 VSYRKNDFFIYDNGTLRLPTNEKASG-EYYCKIEWDESAVISDRITVEYPVLK--------RLFP 163

  Fly   112 GPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIEC--VSVGGKPAAEITWIDGLGN 174
            |.:                        |...|.|.|::.:.:.|  :||   |||..:|..|..:
  Fly   164 GQQ------------------------QAANISALENKPLVLSCPFLSV---PAARFSWYFGNDS 201

  Fly   175 VLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNT-ADRTYRSA--KIRVEVK-- 234
            :..||          .........|.|...:......:.|.|||| |.:|:|..  :::||.|  
  Fly   202 LTNDN----------SALILTNGTLILRHLRLEQAGKYKCVAQNTFASKTHRQFIWQLQVEPKDA 256

  Fly   235 -YAPKVKVNVMGS-------LPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVR 291
             :.||.:..:..:       ||.....:|....|||              |.|:|.|.|:  .|.
  Fly   257 TFYPKNEAGITETAVSEAQLLPAFQNATVFVPAGGS--------------VLLQCHAVAD--FVP 305

  Fly   292 YRWFI---NDEPI-IGGQKTEMVIRNVTRKFHDAIVKC----EVQNSVGKSEDSETLDISYAPSF 348
            ..|::   |::.: :........|.|.:...|:....|    |.||.        .:.::..|..
  Fly   306 IVWYLQPPNNKMVRLSNNSVAYSITNASIARHEGRYSCITPLETQNF--------QVIVTTPPRI 362

  Fly   349 RQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTF------------SVSNE 401
            ..|.......:|...:|||..:.:|:|.|.|..:      |...|.::            |..::
  Fly   363 VSRLPVEVVYIGLSRTLTCRAEGHPEPSITWYHN------GVHLNSSYTRYISGNELHVHSFDSK 421

  Fly   402 TAGRYYCKA-NVPGYAEISADAYVYLKGSPAIGSQR--TQYGLVGDTARIECFASSVPRARH-VS 462
            ..|.|.|.| ||.|             ...|.|..|  .|...|.....|.|:    |.:.| ::
  Fly   422 EEGIYQCVARNVAG-------------EDSATGELRFNRQLEEVNPLQNIRCY----PHSFHSIN 469

  Fly   463 WTFNGQEISS 472
            .||:.:.::|
  Fly   470 ITFDSRTLTS 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 18/82 (22%)
Ig 42..114 CDD:299845 18/66 (27%)
C2-set_2 135..225 CDD:285423 23/92 (25%)
Ig_3 265..329 CDD:290638 13/71 (18%)
I-set 346..420 CDD:254352 20/86 (23%)
Ig 360..425 CDD:299845 18/77 (23%)
Ig5_KIRREL3-like 428..524 CDD:143235 12/48 (25%)
IG_like 435..524 CDD:214653 10/41 (24%)
plumNP_001163744.1 IG_like 170..241 CDD:214653 21/83 (25%)
IGc2 175..235 CDD:197706 15/72 (21%)
IG_like 284..356 CDD:214653 19/95 (20%)
I-set 360..443 CDD:254352 22/101 (22%)
IGc2 378..435 CDD:197706 16/62 (26%)
FN3 804..886 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.