DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and dpr15

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:613 Identity:113/613 - (18%)
Similarity:181/613 - (29%) Gaps:205/613 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QTAV--VGARVTLPCRVINKQ---GTLQWTKDDFGLGTSRDLSGF---ERYAMVGSDEEGDYSLD 93
            ||.:  .|....|||.|  ||   ..:.|.:...|...:.|.:.|   :|:..|.|.....:||.
  Fly   197 QTIISQAGTHAYLPCNV--KQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQ 259

  Fly    94 IYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIEC-VS 157
            |..|.|.|:..|:||||..|:....:...      :|.|:...|.: ...:.....:|::.| :|
  Fly   260 IKYVQLKDEGTYECQVSTEPKASAIVHLR------IVEPKTELIGE-STRHVKAGSQVKLRCIIS 317

  Fly   158 VGGKPAAEITWIDGLGNVLTDN-----IEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQ 217
            ...:|...|.|......:...|     .|...|.||.:           .|......|..:..|.
  Fly   318 QALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAE-----------VPTTSTTTTTTTTTAS 371

  Fly   218 NTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECR 282
            .|...|                     .:.|.....:..|:..|:....|.:.:|          
  Fly   372 TTTTTT---------------------STTPATPSTTATGSTEGATSSETLNGLV---------- 405

  Fly   283 ADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKF-HDAIVKCEVQN---SVGKSEDSETLDIS 343
                                          .:||.: .|||.:.:|..   :.|.:..:||    
  Fly   406 ------------------------------TITRSYILDAISQNDVSELGAAAGVAVATET---- 436

  Fly   344 YAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSNETAGRYYC 408
                             |...|..||::            :....||||......|...|   |.
  Fly   437 -----------------STAQLLTEVEA------------TSSTSGTSTGAGLLASTSAA---YA 469

  Fly   409 KANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRARHVSWTFNGQEISSE 473
            .....|....:.       |..|..:..|...|....|.....|::.......|.:|..|..:: 
  Fly   470 AGAAAGITTAAT-------GDSAATAATTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQITTA- 526

  Fly   474 SGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGG 538
                 |:::.||        :..||     |.|.|:..|.....:....|..:.|.|.:.:  |.
  Fly   527 -----SLIIPAV--------VKLDS-----GNYTCSPSNSAPRTIVLHVLNGEYSASAIKS--GS 571

  Fly   539 ISVVAFL---------LVLTILVVVYI----------------KCKKRTKL------PPADVISE 572
            :|..|.:         .|.|:|.:::|                |...||.|      ..|||..|
  Fly   572 VSWSALIGCHGYLHWRNVSTLLTLLWIIKFALARDICQPNATSKATTRTSLLRAGDGATADVTRE 636

  Fly   573 ---------HQITKNGGVSCKLEPGDRT 591
                     |:::.:  :|......|:|
  Fly   637 TGPKSGASFHRVSSS--ISATKVAEDKT 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 28/100 (28%)
Ig 42..114 CDD:299845 25/77 (32%)
C2-set_2 135..225 CDD:285423 17/95 (18%)
Ig_3 265..329 CDD:290638 8/64 (13%)
I-set 346..420 CDD:254352 12/73 (16%)
Ig 360..425 CDD:299845 12/64 (19%)
Ig5_KIRREL3-like 428..524 CDD:143235 18/95 (19%)
IG_like 435..524 CDD:214653 16/88 (18%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 28/99 (28%)
V-set 204..290 CDD:284989 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.