DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and dpr17

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:266 Identity:58/266 - (21%)
Similarity:98/266 - (36%) Gaps:62/266 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TAVVGARVTLPCRVIN-KQGTLQWTKDDFGLGTSRDLSGF---ERYAMVGSDEEGDY--SLDIYP 96
            ||.:|....:||::.. ....:.|.:.......|.|.:.|   ||:..: ..|:.||  ||.|..
  Fly   416 TAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSI-YQEDHDYTWSLQIKY 479

  Fly    97 VMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVI-YATEDRKVEIECVSVGG 160
            |...|...|:||::..|:....:.      ..:|.|:...|  ||.. :.....||.:.|:..|.
  Fly   480 VEPSDAGWYECQMATEPKLSAKVH------LQIV
KPKTELI--GDQSRFVKAGSKVALHCIVRGT 536

  Fly   161 -KPAAEITWIDGLGNVLTDNIE----YTVI------PLPDQRRFTAKSVLRLTPKKEHHNTNFSC 214
             .|...|.|..|...: :|:.|    ||.:      .:.|.:......::.|..|::  :.|::|
  Fly   537 LDPPKYIIWFRGQKKI-SDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKED--SGNYTC 598

  Fly   215 QAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVE------ 273
            |..|       |..:.|::..                   :.|....|..|||.:|..:      
  Fly   599 QPSN-------SVSVSVDLHV
-------------------LSGEYSASAIMSTAARTTKGGRSTC 637

  Fly   274 HSQVRL 279
            ||.:.|
  Fly   638 HSTLGL 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 23/97 (24%)
Ig 42..114 CDD:299845 20/77 (26%)
C2-set_2 135..225 CDD:285423 22/101 (22%)
Ig_3 265..329 CDD:290638 7/21 (33%)
I-set 346..420 CDD:254352
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 20/75 (27%)
Ig 415..507 CDD:299845 23/97 (24%)
IG_like 521..612 CDD:214653 21/100 (21%)
IGc2 524..605 CDD:197706 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.