DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and Ama

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:108/277 - (38%) Gaps:20/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GSVHMSTGSRIVEH--SQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHD-AI 322
            |.:.:|...|..|.  :.|.|..|...:..|.||...:.:.|..|.......|:|:  :..| ..
  Fly    60 GQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNI--EVSDMGP 122

  Fly   323 VKCEV-QNSVGKSEDSETLDISYAPSFRQR-PQSMEADVGSVVSLTCEVDSNPQPEIVW------ 379
            .:|:| .::..|.....:|.|...|...:. |:|.....|..:.|||..:..|:|.|.|      
  Fly   123 YECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNA 187

  Fly   380 IQHPSDRVVGTSTNLTFSVSNETAGRYYCKA-NVPGYAEISADAYVYLKGSPAIGSQRTQYG-LV 442
            :......::...|....||.....|.|||.| |..|..: .....|.::..|.|..||.:.. :|
  Fly   188 VMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPD-KRLIRVEVEFRPQIAVQRPKIAQMV 251

  Fly   443 GDTARIECFASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYH-YGKY 506
            ..:|.:||.....| |..|.|..||..:.|...|:  :...|...|..::::..||.... :|.|
  Fly   252 SHSAELECSVQGYP-APTVVWHKNGVPLQSSRHHE--VANTASSSGTTTSVLRIDSVGEEDFGDY 313

  Fly   507 NCTVVNDYGNDVAEIQL 523
            .|...|..|:..|.:.|
  Fly   314 YCNATNKLGHADARLHL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 16/67 (24%)
I-set 346..420 CDD:254352 21/81 (26%)
Ig 360..425 CDD:299845 18/71 (25%)
Ig5_KIRREL3-like 428..524 CDD:143235 27/98 (28%)
IG_like 435..524 CDD:214653 25/91 (27%)
AmaNP_731114.2 I-set 33..143 CDD:254352 19/84 (23%)
Ig 37..127 CDD:299845 16/68 (24%)
IG_like 154..234 CDD:214653 21/80 (26%)
IGc2 161..223 CDD:197706 17/61 (28%)
I-set 254..330 CDD:254352 21/78 (27%)
IGc2 254..322 CDD:197706 19/70 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.