DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and dpr16

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:254 Identity:49/254 - (19%)
Similarity:95/254 - (37%) Gaps:74/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QRFAMEPQDQTAVVGARVTLPCRVINKQG-TLQWT--KDDF------------------------ 65
            ::.::.|.:.|...|....|||::....| .|.|.  :|:.                        
  Fly   199 RQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTL 263

  Fly    66 -------GLGTSRD----LSGFERYAMVGSDEEGD-----YSLDIYPVMLDDDARYQCQVSPGPE 114
                   .|.|:..    |.....:|:.|..|.|:     ::|.|..|.|:|...|:||::..|:
  Fly   264 TTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPK 328

  Fly   115 GQPAIRSTFAGLTVLVPPEAPKITQGDVI-----YATEDRKVEIECVSVGGKPAAE-ITWIDGLG 173
            ....::     |.|:.|       :.::|     :.....:||:.|:..|...|.: |.|..|..
  Fly   329 MSAKVQ-----LFVITP-------RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQ 381

  Fly   174 NVLTDN------------IEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTA 220
            .|..:|            |:..:....:..|.|..|:: :...::.|:.|::|:.:|:|
  Fly   382 QVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLV-IPLVRKIHSGNYTCEPENSA 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 28/138 (20%)
Ig 42..114 CDD:299845 23/114 (20%)
C2-set_2 135..225 CDD:285423 20/104 (19%)
Ig_3 265..329 CDD:290638
I-set 346..420 CDD:254352
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 27/136 (20%)
Ig <298..338 CDD:299845 10/44 (23%)
IG_like 352..447 CDD:214653 19/89 (21%)
Ig 358..439 CDD:143165 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.