DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and LSAMP

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:384 Identity:88/384 - (22%)
Similarity:136/384 - (35%) Gaps:79/384 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 KIRVEVKYAPKVKVNVMGSLPGGAG-GSVG-GAGGGSVHMSTGSRIVEHSQVRLECRADANPSDV 290
            :::.:.|..|.|.:.::..||.|.. .||. ..|..::.:..|...:      |.|..:...|.|
Human     4 RVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI------LRCVVEDKNSKV 62

  Fly   291 RYRWFINDEPII--GGQKTEMVIRNVTRKFH---------------DAIVKCEVQNSVGKSEDSE 338
            .:   :|...||  |..|..:..|....|.|               :....|.||..........
Human    63 AW---LNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQV 124

  Fly   339 TLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQH--PSDR-VVGTSTNL-TFSVS 399
            .|.:...|........:..:.||.|:|.|..:..|:|.|.| :|  |:.| ..|....| ...::
Human   125 YLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITW-RHLTPTGREFEGEEEYLEILGIT 188

  Fly   400 NETAGRYYCK-ANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRARHVSW 463
            .|.:|:|.|| ||....|::. ...|.:...|.|...::.....|..|.::|.||:|| |....|
Human   189 REQSGKYECKAANEVSSADVK-QVKVTVNYPPTITESKSNEATTGRQASLKCEASAVP-APDFEW 251

  Fly   464 --------TFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAE 520
                    :.||.||.|..|              :|:|.:.:....|||.|.|...|..|...|.
Human   252 YRDDTRINSANGLEIKSTEG--------------QSSLTVTNVTEEHYGNYTCVAANKLGVTNAS 302

  Fly   521 IQLQAK--------------------KSVSLLMTIVGGISV-VAFLLVLTILVVVYIKC 558
            :.|..:                    |....:..|.|.||: |...|:...|:.:..||
Human   303 LVLFKRVLPTIPHPIQEIGTTVHFKQKGPGSVRGINGSISLAVPLWLLAASLLCLLSKC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 15/80 (19%)
I-set 346..420 CDD:254352 23/78 (29%)
Ig 360..425 CDD:299845 22/69 (32%)
Ig5_KIRREL3-like 428..524 CDD:143235 27/103 (26%)
IG_like 435..524 CDD:214653 25/96 (26%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 17/98 (17%)
Ig 132..215 CDD:386229 24/84 (29%)
Ig_3 219..294 CDD:372822 24/89 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.