Sequence 1: | NP_001284835.1 | Gene: | rst / 31290 | FlyBaseID: | FBgn0003285 | Length: | 764 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_729591.1 | Gene: | dpr10 / 39180 | FlyBaseID: | FBgn0052057 | Length: | 408 | Species: | Drosophila melanogaster |
Alignment Length: | 335 | Identity: | 71/335 - (21%) |
---|---|---|---|
Similarity: | 101/335 - (30%) | Gaps: | 133/335 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 PQDQTAVVGARVTLPCRV-----------------INKQGTLQWTKDD-FGLGTSRDLSGFERYA 80
Fly 81 MVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTV--LVPPEAPKITQ---- 139
Fly 140 GDVIYATEDRKVE------------IECVSV------GG---------------------KPAAE 165
Fly 166 ITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIR 230
Fly 231 VEV-----------KYAPKV---------------KVNVMGSL----------------PGGAGG 253
Fly 254 SVGG---AGG 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rst | NP_001284835.1 | IG_like | 34..130 | CDD:214653 | 27/115 (23%) |
Ig | 42..114 | CDD:299845 | 20/89 (22%) | ||
C2-set_2 | 135..225 | CDD:285423 | 24/132 (18%) | ||
Ig_3 | 265..329 | CDD:290638 | |||
I-set | 346..420 | CDD:254352 | |||
Ig | 360..425 | CDD:299845 | |||
Ig5_KIRREL3-like | 428..524 | CDD:143235 | |||
IG_like | 435..524 | CDD:214653 | |||
dpr10 | NP_729591.1 | Ig | 63..143 | CDD:299845 | 22/93 (24%) |
IG_like | 210..297 | CDD:214653 | 17/92 (18%) | ||
IGc2 | 217..287 | CDD:197706 | 11/70 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |