DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and dpr10

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:335 Identity:71/335 - (21%)
Similarity:101/335 - (30%) Gaps:133/335 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PQDQTAVVGARVTLPCRV-----------------INKQGTLQWTKDD-FGLGTSRDLSGFERYA 80
            |::.|::||....|.|||                 |...||..:|.|. |.....||:.      
  Fly    60 PRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDID------ 118

  Fly    81 MVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTV--LVPPEAPKITQ---- 139
                    :::|.|......|...|:||:|..|     :||....|.:  |:..|...|.|    
  Fly   119 --------EWTLQIKWAQQRDAGVYECQISTQP-----VRSYSVNLNIVDLIDAETSDIMQQYYN 170

  Fly   140 GDVIYATEDRKVE------------IECVSV------GG---------------------KPAAE 165
            .|..|..|:|..:            |:.|:|      ||                     :|...
  Fly   171 DDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTH 235

  Fly   166 ITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIR 230
            |.|.. ...||::......:.....:....||:|.:......|:..:||...||     ..|.||
  Fly   236 IFWYH-QDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNT-----EIASIR 294

  Fly   231 VEV-----------KYAPKV---------------KVNVMGSL----------------PGGAGG 253
            |.|           ..||..               .|.|:.::                .||.||
  Fly   295 VHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGGGGG 359

  Fly   254 SVGG---AGG 260
            ..||   |||
  Fly   360 CPGGGSPAGG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 27/115 (23%)
Ig 42..114 CDD:299845 20/89 (22%)
C2-set_2 135..225 CDD:285423 24/132 (18%)
Ig_3 265..329 CDD:290638
I-set 346..420 CDD:254352
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
dpr10NP_729591.1 Ig 63..143 CDD:299845 22/93 (24%)
IG_like 210..297 CDD:214653 17/92 (18%)
IGc2 217..287 CDD:197706 11/70 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.