DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and dpr13

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:271 Identity:75/271 - (27%)
Similarity:110/271 - (40%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TAVVGARVTLPCRVIN-KQGTLQW-TKDDF-----GLGTSRDLSGFERYAMVGSDEEGDYSLDIY 95
            |..:||...:||.|.: .:|.:.| .|.|:     ||.|   .|..||::........|::|.|.
  Fly   186 TTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTT---YSSDERFSATHLKHSEDWTLQIK 247

  Fly    96 PVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEA-PKITQGDVIYATEDRKVEIECVSVG 159
            .|.|.|...|:||||..|.     .|.|..|:|:   || .:||...:.|.|....:.::|..|.
  Fly   248 FVQLRDAGVYECQVSTHPP-----TSIFLHLSVV
---EARAEITGPPIRYLTPGSTLRLQCRVVQ 304

  Fly   160 GKPAAE-ITW----------IDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFS 213
            ...|:| |.|          ||...||.|:         ||.:    .|.|.:...:..|:.||:
  Fly   305 NTEASEYIFWYHDNRMINYDIDRGINVSTE---------PDFQ----SSELTIQRTRREHSGNFT 356

  Fly   214 CQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGA-GGSVGGA---GGGSVHM-----STGS 269
            |.|.||     :.|.:.|.:         ..|..|... .|.|||:   ....:||     ::|.
  Fly   357 CVASNT
-----QPASVLVHI---------FKGDNPAAMYHGHVGGSTKTTQSQLHMIMIIIASGY 407

  Fly   270 RIVEHSQVRLE 280
            ||. |:.|.::
  Fly   408 RIF-HTSVYMK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 32/98 (33%)
Ig 42..114 CDD:299845 26/78 (33%)
C2-set_2 135..225 CDD:285423 26/100 (26%)
Ig_3 265..329 CDD:290638 6/21 (29%)
I-set 346..420 CDD:254352
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
dpr13NP_001033956.2 V-set 180..276 CDD:284989 31/97 (32%)
IG_like 182..262 CDD:214653 25/78 (32%)
IG_like 285..362 CDD:214653 22/89 (25%)
IGc2 292..361 CDD:197706 20/81 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.