DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and ImpL2

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:232 Identity:47/232 - (20%)
Similarity:85/232 - (36%) Gaps:48/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 EVQNSVGKSED---SETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWI------- 380
            :|.||:...|:   :...:..:....:..|..::...|:.:.:.||:..:..|.|.|:       
  Fly    36 DVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRS 100

  Fly   381 ------------QHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIG 433
                        :.||..|...|:::...|.:| |..|.|.... |...|.|...|:...|..:.
  Fly   101 ELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSE-ARTYTCVGRT-GSKTIYASTVVHPPRSSRLT 163

  Fly   434 SQRTQYG---------------LVGDTARIECFASSVPRARHVSWTFNGQEISSESGHDYSILVD 483
            .::|..|               |:|...::.|...:.||| .::| .|.:......||.:.:|.:
  Fly   164 PEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRA-EITW-LNNENKEIVQGHRHRVLAN 226

  Fly   484 AVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAE 520
                   ..|:|.:.:....|.|.|...|..|.|.|:
  Fly   227 -------GDLLISEIKWEDMGNYKCIARNVVGKDTAD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 1/2 (50%)
I-set 346..420 CDD:254352 18/92 (20%)
Ig 360..425 CDD:299845 18/83 (22%)
Ig5_KIRREL3-like 428..524 CDD:143235 23/108 (21%)
IG_like 435..524 CDD:214653 22/101 (22%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.