DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and babos

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:180 Identity:42/180 - (23%)
Similarity:60/180 - (33%) Gaps:49/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 KTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISY------APSFRQRPQ----------- 353
            :|:::|..:......|.|....|:|:...:.....|..|      |||    ||           
  Fly     4 RTDLLIAGLLLIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQSAPS----PQTKSPNPVASEK 64

  Fly   354 -----SMEADVGSVVSLTCEVDSN-PQPEIVWIQHPSDRVVGTSTNLT--------------FSV 398
                 |:....|..|.|.|:|.|| ...::|.:.:..|.|:....||.              ...
  Fly    65 INKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKLDANYDLTILKA 129

  Fly   399 SNETAGRYYCKANVPG--------YAEISADAYVYLKGSPAIGSQRTQYG 440
            |.:.||.|.||....|        .||.|.||......:.|.||..:..|
  Fly   130 SPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDAIAPESSTSAAGSASSFLG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 4/22 (18%)
I-set 346..420 CDD:254352 26/112 (23%)
Ig 360..425 CDD:299845 24/87 (28%)
Ig5_KIRREL3-like 428..524 CDD:143235 4/13 (31%)
IG_like 435..524 CDD:214653 1/6 (17%)
babosNP_001286719.1 ig 70..154 CDD:278476 20/83 (24%)
IG_like 70..154 CDD:214653 20/83 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.