DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and CG17716

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001286391.1 Gene:CG17716 / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster


Alignment Length:542 Identity:115/542 - (21%)
Similarity:192/542 - (35%) Gaps:124/542 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAM 81
            :|..|...|:.:..::...:|    .:.:.|.|.|.....|..|.|:      .:.:...:|.|.
  Fly   230 LRPVPPNPYEAEEMSVVYAEQ----HSEIKLMCEVDLDIATSMWYKN------GQVVHAMDRTAR 284

  Fly    82 VGSD----EEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTF----AGLTVLVPPEAPKI- 137
            | :|    :|.:.:|.|..|||:||.::||      |.:...|.|.    ..|.||..|:.|.: 
  Fly   285 V-TDYRFIKEANGALTITNVMLEDDGKWQC------EAENTRRYTENARPVKLVVLDRPKPPYLL 342

  Fly   138 -------TQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVL--------TDNIEYTVIPL 187
                   .....:...|:.::.:.|||.||.|...:||     .||        ...:...|:.|
  Fly   343 IDSRRLDASNLFVPVKENSELNLACVSEGGNPRPTLTW-----EVLLSPGVDRHAQKVSAEVLEL 402

  Fly   188 PDQR-----------RFTAKSVLRL-TPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVK 240
            .:.:           ...|||..|| ...:.|||....|..::...:..::|.:.::|:|.|...
  Fly   403 EEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFA 467

  Fly   241 VNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADAN-PSDVRYRWFINDEPIIGG 304
            ::   ..||                 .|..:.|..:|.|:|..|:| ||..|::....|.|:   
  Fly   468 IS---RTPG-----------------FGYPLREGIEVSLKCDVDSNPPSTPRWQKDDGDTPV--- 509

  Fly   305 QKTEMVIRNVT--RKFHDAIVKCEVQ-----------------NSVGKSEDSETLDISY-APSFR 349
            .:|.....|.|  |:.|....||..:                 :||..:.:.:..|:|. |.|..
  Fly   510 PQTGDGFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYLSVRFDSVDVTSEPDDQDVSVAAASHN 574

  Fly   350 QRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSNET------------ 402
            .....:|..:|..|:|.|     ||..:....| .|.:......|.:..|..|            
  Fly   575 PNKGQLEVQLGGAVTLQC-----PQGSLGCWSH-LDPISARLRGLGYGSSQPTGQFSLKDVMYQD 633

  Fly   403 AGRYYCKANVP---GYAEISADAYVYLKGSPAI-GSQRTQYGLVGDTARIECFASSVPRARHVSW 463
            ||.|.|....|   ...|:.....|.:||:|.: ....|.....|....:.....:.|.|....|
  Fly   634 AGMYKCVGQSPTNKKKLEVLQSVTVSVKGAPTVMALNATPVAYPGSPLHLNVEFCANPPAHAARW 698

  Fly   464 TFNGQEISSESGHDYSILVDAV 485
            ....:..:..:.:..::|..||
  Fly   699 LHGDRVFTPGNQYGTTVLAYAV 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 26/103 (25%)
Ig 42..114 CDD:299845 20/75 (27%)
C2-set_2 135..225 CDD:285423 23/117 (20%)
Ig_3 265..329 CDD:290638 19/83 (23%)
I-set 346..420 CDD:254352 19/88 (22%)
Ig 360..425 CDD:299845 17/79 (22%)
Ig5_KIRREL3-like 428..524 CDD:143235 10/59 (17%)
IG_like 435..524 CDD:214653 8/51 (16%)
CG17716NP_001286391.1 IG_like 244..332 CDD:214653 25/104 (24%)
Ig 254..323 CDD:143165 22/81 (27%)
Ig 359..452 CDD:299845 22/97 (23%)
Ig_3 477..536 CDD:290638 18/61 (30%)
IG_like 479..550 CDD:214653 18/73 (25%)
IG_like 578..660 CDD:214653 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.