DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and Sdk2

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:521 Identity:110/521 - (21%)
Similarity:176/521 - (33%) Gaps:180/521 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PQDQTAVVG-ARVTLPCRVINKQGTLQ----WTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLD 93
            |::.:.|.| :.||:.| |.|.:..::    |.||  |...|..:|.:.|            .|.
  Rat   224 PKNTSVVAGTSEVTMEC-VANARPLIKLHIVWKKD--GALLSNGISDYNR------------RLT 273

  Fly    94 IYPVMLDDDARYQCQ-------VSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKV 151
            |...|:.|...|:|:       |:|...|        |.|:||.||:..:..:.. |.|..::.|
  Rat   274 ITNPMVSDAGYYECEAMLRSSSVAPVTRG--------AYLSVLEPPQFVREPERH-ITAEMEKVV 329

  Fly   152 EIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQA 216
            :|.| ...|.|...|||                                                
  Rat   330 DIPC-RAKGVPPPSITW------------------------------------------------ 345

  Fly   217 QNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLEC 281
                   |:.|.: |||           |.|                             .|.:.
  Rat   346 -------YKDAAL-VEV-----------GKL-----------------------------TRFKQ 362

  Fly   282 RADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDI-SYA 345
            |:|                  ||.:...::.:.|     .:|:|...|:.|:::.|..|.: |.|
  Rat   363 RSD------------------GGLQISGLLPDDT-----GMVQCFAHNAAGEAQTSTYLAVTSIA 404

  Fly   346 PSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVW-----------IQHPSDRVVGTSTNLTFSVS 399
            |:..:.|.......|..|.|.||....|:|.|.|           :|.|...::.:.:.|.....
  Rat   405 PNITRGPLDSTVIDGMSVVLACETSGAPRPAITWQKGERILASGSVQLPRFTLLESGSLLISPTH 469

  Fly   400 NETAGRYYCKA-NVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPR--ARHV 461
            ...||.|.|.| |..|..|.|||..|:.: :......:.|..:.|..|.:.|..:..||  .|:|
  Rat   470 ISDAGTYTCLATNSRGVDEASADLVVWAR-TRITKPPQDQSVIKGTQASMVCGVTHDPRVTVRYV 533

  Fly   462 SWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAK 526
             |..:|..::.|:  :..|.:|.     ..:|.|..:.:...|.|.|.|::..|||.....|:.:
  Rat   534 -WEKDGATLAVET--NPRIRLDR-----NGSLHISQTWSGDIGTYTCRVLSAGGNDSRNAHLRVR 590

  Fly   527 K 527
            :
  Rat   591 Q 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 27/107 (25%)
Ig 42..114 CDD:299845 21/83 (25%)
C2-set_2 135..225 CDD:285423 10/89 (11%)
Ig_3 265..329 CDD:290638 8/63 (13%)
I-set 346..420 CDD:254352 22/85 (26%)
Ig 360..425 CDD:299845 23/76 (30%)
Ig5_KIRREL3-like 428..524 CDD:143235 22/97 (23%)
IG_like 435..524 CDD:214653 22/90 (24%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653
Ig 135..191 CDD:299845
IG_like 225..307 CDD:214653 25/104 (24%)
IGc2 236..289 CDD:197706 18/67 (27%)
I-set 311..400 CDD:254352 30/209 (14%)
Ig 329..397 CDD:143165 26/187 (14%)
I-set 405..495 CDD:254352 25/89 (28%)
Ig 419..495 CDD:299845 23/75 (31%)
Ig 505..589 CDD:299845 23/91 (25%)
IG_like 505..589 CDD:214653 23/91 (25%)
FN3 593..684 CDD:238020
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.