DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and LRIT3

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:427 Identity:92/427 - (21%)
Similarity:147/427 - (34%) Gaps:115/427 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 MSTGSRIVEHSQVRLECRADANPSDVRYRWF-------------INDEPIIGGQKTEMVIRNVTR 316
            :||.|.:::.|..|:......||      ||             :.|..|:              
Human   180 VSTPSGVLDLSPSRIILGLQDNP------WFCDCHISKMIELSKVVDPAIV-------------- 224

  Fly   317 KFHDAIVKC-EVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWI 380
             ..|.::.| |.:...|.......|:....||.......:.:.:||.|.|.|:....|.|:|.|.
Human   225 -LLDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQITWT 288

  Fly   381 -------------QHPSDRVVGTSTNLTFSVSNETAGRYYCKA-NVPGYAEISADAYVYLKG--- 428
                         :.|.:.|..:..:|| .:|::.||.|.||| |:.|.:|  |...|.:.|   
Human   289 RSDSSPVNYTVIQESPEEGVRWSIMSLT-GISSKDAGDYKCKAKNLAGMSE--AVVTVTVLGITT 350

  Fly   429 --SPAIGSQRT----QYGLVGDTARIECFASSVPRARHVSW--------TFNGQEISSESGHDYS 479
              .|...|:||    ::.:...:.|    ::||..|....|        :|:...:|..|...:|
Human   351 TPIPPDTSERTGDHPEWDVQPGSGR----STSVSSASSYLWSSSFSPTSSFSASTLSPPSTASFS 411

  Fly   480 ILVDAVPGGVKSTLII-------------RDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSL 531
             |.......|.||..:             |..|.:..||.|..|..: |:.:.......|:.::|
Human   412 -LSPFSSSTVSSTTTLSTSISASTTMANKRSFQLHQGGKRNLKVAKN-GSKLPPASTSKKEELAL 474

  Fly   532 LMTIVGGISVVAFLLVLTILVVVYIKCKKRTK----LPPADVISEHQ------ITKNGGVSCKLE 586
            |...         :|..|...:..::....||    |....:.:.|.      .:|.||....|.
Human   475 LDQT---------MLTETNAAIENLRVVSETKESVTLTWNMINTTHNSAVTVLYSKYGGKDLLLL 530

  Fly   587 PGDRTSNYSDLKVDISGGYVPYGDYSTHYSP---PPQ 620
            ..|.:.|  .:.:|   |..|.|.|.....|   |||
Human   531 NADSSKN--QVTID---GLEPGGQYMACVCPKGVPPQ 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 14/77 (18%)
I-set 346..420 CDD:254352 25/87 (29%)
Ig 360..425 CDD:299845 24/78 (31%)
Ig5_KIRREL3-like 428..524 CDD:143235 25/125 (20%)
IG_like 435..524 CDD:214653 22/113 (19%)
LRIT3NP_940908.3 LRR 1 56..79
leucine-rich repeat 59..82 CDD:275378
LRR_8 61..117 CDD:290566
LRR 2 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3 104..128
LRR_8 105..165 CDD:290566
LRR_4 105..146 CDD:289563
leucine-rich repeat 107..130 CDD:275378
LRR 4 129..151
LRR_4 131..170 CDD:289563
leucine-rich repeat 131..154 CDD:275378
LRR 5 152..175
leucine-rich repeat 155..168 CDD:275378
Ig 267..345 CDD:299845 25/80 (31%)
IG_like 267..345 CDD:214653 25/80 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..375 4/23 (17%)
FN3 486..550 CDD:214495 14/68 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.