DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and DIP-eta

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:452 Identity:89/452 - (19%)
Similarity:163/452 - (36%) Gaps:128/452 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RFAMEPQDQTAVVGARVTLPCRVINKQG--TLQWTKDDFGLGTSRDLSGFERYAM-------VGS 84
            :|:....:.||.||....|.| |:...|  .:.|.:.|     ::.:...:.:.:       :.:
  Fly    44 KFSSPIVNMTAPVGRDAFLTC-VVQDLGPYKVAWLRVD-----TQTILTIQNHVITKNQRIGIAN 102

  Fly    85 DEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDR 149
            .|...:::.|..:...|...|.||::..|     ::|....|.|:|||:.........:...|..
  Fly   103 SEHKTWTMRIKDIKESDKGWYMCQINTDP-----MKSQMGYLDVVVPPDILDYPTSTDMVVREGS 162

  Fly   150 KVEIECVSVGGKPAAEITWIDGLG---NVLTD----NIEYTVIPLPDQRRFTAKSVLRLTPKKEH 207
            .|.::|.:. |.|...|||....|   .:.|.    :||.|.:.:|:.||              |
  Fly   163 NVTLKCAAT-GSPEPTITWRRESGVPIELATGEEVMSIEGTDLVIPNVRR--------------H 212

  Fly   208 HNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIV 272
            |...:.|.|.|....:. |.:|.:.|.:.|  .:.|...|.|.                     |
  Fly   213 HMGAYLCIASNGVPPSV-SKRITLVVHFPP--MITVQNQLIGA---------------------V 253

  Fly   273 EHSQVRLECRADANPSDVRYRW-------------FINDEPIIGGQKTEMVIR-NVTRKFHDAIV 323
            |...|.|:|.::|.|..:.| |             :..:...|||.:..|.:. |...:......
  Fly   254 EGKGVTLDCESEAYPKSINY-WTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSY 317

  Fly   324 KCEVQNSVGKSEDSETL------DISYAPSF------RQRPQSMEADVGSVVSLTCEVDSNPQPE 376
            :|..:||:|.::.:..|      .::|..:|      ::|.:|.|:                   
  Fly   318 RCVAKNSLGDTDGTIKLYRIPPNAVNYVENFEARHKGKKRTKSSES------------------- 363

  Fly   377 IVWIQHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQ 438
                .||:.....:..::      |..|:.  ||::    .:.|::...:.|:.|.||:|.|
  Fly   364 ----HHPARAQEHSGEDM------ENPGKR--KADL----SLGAESIDSIYGNSAAGSRRRQ 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 20/104 (19%)
Ig 42..114 CDD:299845 13/80 (16%)
C2-set_2 135..225 CDD:285423 21/96 (22%)
Ig_3 265..329 CDD:290638 15/77 (19%)
I-set 346..420 CDD:254352 10/79 (13%)
Ig 360..425 CDD:299845 7/64 (11%)
Ig5_KIRREL3-like 428..524 CDD:143235 6/11 (55%)
IG_like 435..524 CDD:214653 2/4 (50%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 19/100 (19%)
IG_like 51..137 CDD:214653 18/96 (19%)
IG_like 153..237 CDD:214653 23/99 (23%)
Ig 161..224 CDD:299845 19/77 (25%)
IG_like 252..335 CDD:214653 18/104 (17%)
Ig 258..333 CDD:143165 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.