DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and fred

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster


Alignment Length:957 Identity:192/957 - (20%)
Similarity:329/957 - (34%) Gaps:302/957 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LHTMQLLLLATI---VGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKD 63
            :.|::||::..:   :|::....         :::.::     |..:.|.||.     |..:...
  Fly     1 MSTIKLLIIGQLWLSIGLISGDD---------SLDTRE-----GVDLVLKCRF-----TEHYDST 46

  Fly    64 DFGLGTSRDL---SGFERYAMVGSDEEGDYSLD------IYPVMLD------DDARYQCQVSPGP 113
            ||....:|..   :.||..|:.......:|.||      ||.:.:.      |:.|::|::....
  Fly    47 DFTFYWARWTCCPTLFENVAIGDVQLNSNYRLDFRPSRGIYDLQIKNTSYNRDNGRFECRIKAKG 111

  Fly   114 EGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTD 178
            .|.. :...|..||||..|..|.:|.|::..|||::.:|:.|.|:||.|...|||..        
  Fly   112 TGAD-VHQEFYNLTVLTAPHPPMVTPGNLAVATEEKPLELTCSSIGGSPDPMITWYR-------- 167

  Fly   179 NIEYTVIPLPD------QRRFTAKSVLRLTPKKEHHNTNFSCQAQNTA--DRTYRSAKIRVEVKY 235
              |.:.:||..      .:.....:.|::.|::......:.|...|.|  :.......:.:.|.|
  Fly   168 --EGSTVPLQSYALKGGSKNHYTNATLQIVPRRADDGAKYKCVVWNRAMPEGHMLETSVTLNVNY 230

  Fly   236 APKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQV-RLECRADANPSDVRYRWFINDE 299
            .|:|:|.....|.                       ||...| :|:||.||.|.....||..|.:
  Fly   231 YPRVEVGPQNPLK-----------------------VERDHVAKLDCRVDAKPMVSNVRWSRNGQ 272

  Fly   300 PIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSE-TLDISYAPSFRQRPQSMEADVGSVV 363
             .:....|..:.|  ..:.|.....|...|.:||:.:.: .||:.|.|......::.||:.|..|
  Fly   273 -YVSATPTHTIYR--VNRHHAGKYTCSADNGLGKTGEKDIVLDVLYPPIVFIESKTHEAEEGETV 334

  Fly   364 SLTCEVDSNPQP-EIVWIQH--PSDRVVGTSTNLTFSVSNETAGRYYCKA-NV------------ 412
            .:.|.|.:||.| .:.|::.  |..|..|....|. ||..|.||.|.|:: |:            
  Fly   335 LIRCNVTANPSPINVEWLKEGAPDFRYTGELLTLG-SVRAEHAGNYICRSVNIMQPFSSKRVEGV 398

  Fly   413 ------------PGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFAS----SVPRARHV 461
                        ||.|.|:.:       .|.:.        ||:...:.|.|:    .||:.|  
  Fly   399 GNSTVALLVRHRPGQAYITPN-------KPVVH--------VGNGVTLTCSANPPGWPVPQYR-- 446

  Fly   462 SWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYG-NDVAEIQLQA 525
             |.   :::..:.|:...||.......:....:..:      |||:|..||:.| ..:|.|.|:.
  Fly   447 -WF---RDMDGDIGNTQKILAQGPQYSIPKAHLGSE------GKYHCHAVNELGIGKIATIILEV 501

  Fly   526 KKSVSLLMTI-------VGGISVVAFLLVLTILVVVYIKCKKRTK--------------LP---- 565
            .:....|..:       ||.:...             :.|..:.|              ||    
  Fly   502 HQPPQFLAKLQQHMTRRVGDVDYA-------------VTCSAKGKPTPQIRWIKDGTEILPTRKM 553

  Fly   566 ------PAD----VISEHQITK-------NGGVSCKLEPGDR------------TSN-------- 593
                  |.|    |::...|.:       ||.   :|.|.||            ::|        
  Fly   554 FDIRTTPTDAGGGVVAVQSILRFRGKARPNGN---QLLPNDRGLYTCLYENDVNSANSSMHLRIE 615

  Fly   594 --------YSDLKVDI--SGGYV------PYGDYSTHYSPPPQYLTTCSTKSNGSSTIMQNN--H 640
                    |:.:..|:  |...|      |..::...|...|..||..|......||.|:||  :
  Fly   616 HEPIVIHQYNKVAYDLRESAEVVCRVQAYPKPEFQWQYGNNPSPLTMSSDGHYEISTRMENNDVY 680

  Fly   641 QNQLQLQQQQQQSHHQH----------------------HTQTTTLP----------MTFLTNSS 673
            .:.|::...|...:.::                      ..:.|.|.          :.:....:
  Fly   681 TSILRIAHLQHSDYGEYICRAVNPLDSIRAPIRLQPKGSPEKPTNLKILEVGHNYAVLNWTPGFN 745

  Fly   674 GGSL-TGSIIGSREIR----------QDNG-LPSLQSTTASVVSSSPNG-------SCSNQSTTA 719
            ||.: |..::..|.:.          ..|| :||.|     :.|||.|.       :|..::...
  Fly   746 GGFMSTKYLVSYRRVATPREQTLSDCSGNGYIPSYQ-----ISSSSSNSNHEWIEFNCFKENPCK 805

  Fly   720 ATTTTTHVVVPSSM--ALSVDPRYSAIYGNPYLRSSNSSLLPPPTAV 764
            ......|   .|.|  ..:::.:.::.|.|..|.::..|.:|||..|
  Fly   806 LAPLDQH---QSYMFKVYALNSKGTSGYSNEILATTKVSKIPPPLHV 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 24/110 (22%)
Ig 42..114 CDD:299845 19/86 (22%)
C2-set_2 135..225 CDD:285423 23/97 (24%)
Ig_3 265..329 CDD:290638 16/64 (25%)
I-set 346..420 CDD:254352 27/101 (27%)
Ig 360..425 CDD:299845 24/92 (26%)
Ig5_KIRREL3-like 428..524 CDD:143235 21/100 (21%)
IG_like 435..524 CDD:214653 20/93 (22%)
fredNP_608812.3 Ig 29..126 CDD:299845 23/107 (21%)
IG_like 141..228 CDD:214653 20/96 (21%)
Ig 147..228 CDD:299845 17/90 (19%)
I-set 232..313 CDD:254352 24/106 (23%)
IGc2 250..302 CDD:197706 14/54 (26%)
IG_like 323..385 CDD:214653 21/62 (34%)
IGc2 330..385 CDD:197706 19/55 (35%)
Ig_2 416..501 CDD:290606 23/111 (21%)
IG_like 418..501 CDD:214653 22/109 (20%)
I-set 505..612 CDD:254352 18/122 (15%)
Ig 526..611 CDD:143165 15/87 (17%)
IG_like 633..715 CDD:214653 15/81 (19%)
Ig 635..713 CDD:143165 14/77 (18%)
FN3 720..838 CDD:238020 22/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.