DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and DIP-beta

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:538 Identity:117/538 - (21%)
Similarity:193/538 - (35%) Gaps:156/538 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLATIVGMVRSSPYTSYQNQRFAMEP------QDQTAVVGARVTLPCRVINKQG--------- 56
            ||||...:.:..|:..:|..    |.||      ::.|...|...|..| |:|..|         
  Fly    75 LLLLGNCIDLTVSNKISSVG----AFEPDFVIPLENVTIAQGRDATFTC-VVNNLGGHRVSGDGS 134

  Fly    57 ----TLQWTKDDFGLGTSRDLSGFERYAMVGSD----EEGDY---SLDIYPVMLDDDARYQCQVS 110
                .:.|.|.|     ::.:.....:.:..:|    :..||   :|:|..|.::|..:|.|||:
  Fly   135 SAPAKVAWIKAD-----AKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVN 194

  Fly   111 PGPEGQPAIRSTFAGLTVLVPPE-APKITQGDVIYATEDRKVEIECVSVGGKPAAEITW--IDGL 172
            ..|     ::...|.|.|::||: ..:.|.||:: ..|....::.| ...|.|..:|||  .|| 
  Fly   195 TDP-----MKMQTATLEVVIPPDIINEETSGDMM-VPEGGSAKLVC-RARGHPKPKITWRREDG- 251

  Fly   173 GNVLTDNIEYTVIPLPDQRRFTAKSV----LRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEV 233
            ..::..|        ...::..|:||    |.|:.........:.|.|.|....|. |.:::::|
  Fly   252 REIIARN--------GSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTV-SKRMKLQV 307

  Fly   234 KYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFIND 298
            .:.|.|:|                     .:...|:.::  :.|.|.|..:|:|..:.|....|.
  Fly   308 HFHPLVQV---------------------PNQLVGAPVL--TDVTLICNVEASPKAINYWQRENG 349

  Fly   299 EPIIGGQK------------TEMVIRNVTRKFHD-AIVKCEVQNSVGKSEDSETLDISYAPSFRQ 350
            |.||.|.:            .||::.....:..| ...||..:||:|.:|.:..|   |.   .:
  Fly   350 EMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRL---YE---ME 408

  Fly   351 RPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGY 415
            ||       |..:....:::...:.|:|   ....|....|.||.        ||.| |...|  
  Fly   409 RP-------GKKILRDDDLNEVSKNEVV---QKDTRSEDGSRNLN--------GRLY-KDRAP-- 452

  Fly   416 AEISADAYVYLKGSPAIGSQ----RTQYGLVGD---------TARIECFASSV---------PRA 458
                 |.:      ||.||.    |....|:|.         ||..|...:::         .:|
  Fly   453 -----DQH------PASGSDQLLGRGTMRLIGTFLLALLVLFTALAEAGPTTLSCRTKGGRQKKA 506

  Fly   459 RHVSWTFNGQEISSESGH 476
            :..||.........|.||
  Fly   507 KETSWNGRRARDGREDGH 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 26/121 (21%)
Ig 42..114 CDD:299845 20/91 (22%)
C2-set_2 135..225 CDD:285423 22/95 (23%)
Ig_3 265..329 CDD:290638 17/76 (22%)
I-set 346..420 CDD:254352 14/73 (19%)
Ig 360..425 CDD:299845 13/64 (20%)
Ig5_KIRREL3-like 428..524 CDD:143235 16/71 (23%)
IG_like 435..524 CDD:214653 12/64 (19%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 26/121 (21%)
ig 102..195 CDD:278476 21/98 (21%)
IG_like 219..307 CDD:214653 22/99 (22%)
Ig 221..307 CDD:299845 21/97 (22%)
Ig 311..404 CDD:299845 24/115 (21%)
IG_like 327..405 CDD:214653 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.