DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:458 Identity:105/458 - (22%)
Similarity:175/458 - (38%) Gaps:105/458 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHTMQLLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQG-TLQWTKDD 64
            ::|.:.::.|...:|..:.....|..|...|         ||...|..|.|.:..| .:.|.|.|
  Fly    24 LIHLLLIVSLLEAIGAFQPEFVESISNVSVA---------VGRDATFTCHVRHLGGYRVGWLKAD 79

  Fly    65 FGLGTSRDLSGFERYAM-------VGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRST 122
                 ::.:.......:       |...::..::|.|..|..:|...|.||::..|     ::|.
  Fly    80 -----TKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDP-----MKSQ 134

  Fly   123 FAGLTVLVPPE-APKITQGDVIYATEDRKVEIECVSVGGKPAAEITW--IDGLGNVLTDNI-EYT 183
            ...|.|::||: ..:.|..||| ..|...|.:.| ...|.|...:||  .||...||.||: ..|
  Fly   135 IGFLDVVIPPDFISEDTSSDVI-VPEGSSVRLTC-RARGYPEPIVTWRREDGNEIVLKDNVGTKT 197

  Fly   184 VIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKV-NVMGSL 247
            :.|     .|..: ||:|:....:...::.|.|.|....:. |.:|.:.:.:.|.::| |.:...
  Fly   198 LAP-----SFRGE-VLKLSKISRNEMGSYLCIASNGVPPSV-SKRISLSIHFHPVIQVPNQLVGA 255

  Fly   248 PGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFIND--EPIIGGQK---- 306
            |.|                        :.|::||..:|:|..:.| | |.|  |.|:...|    
  Fly   256 PLG------------------------TDVQIECHVEASPKSINY-W-IKDTGEMIVTSGKYHVQ 294

  Fly   307 --------TEMVIRNVTRKFHDAIV---KCEVQNSVGKSEDSETLDISYAPSFRQRP-------- 352
                    |:|.:  :.|||....|   :|..:||:|:.:.|..|.....|:..:.|        
  Fly   295 ESSQSMYETKMSM--IVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGKGG 357

  Fly   353 ---QSMEADVGSVVSLTCEVDSNPQPEIVWIQHPS----DRVVGTSTNLTFSVSNETAGRYYCKA 410
               .|::||...::....:|....|||...:|:.|    :...|....|| .:|...   ||...
  Fly   358 GAGGSLDADANDILKQKQQVKVTYQPEDEELQYGSVEDFEAEGGEGGGLT-PLSPHV---YYTSG 418

  Fly   411 NVP 413
            |.|
  Fly   419 NKP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 21/103 (20%)
Ig 42..114 CDD:299845 16/79 (20%)
C2-set_2 135..225 CDD:285423 26/92 (28%)
Ig_3 265..329 CDD:290638 19/80 (24%)
I-set 346..420 CDD:254352 19/83 (23%)
Ig 360..425 CDD:299845 14/58 (24%)
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 19/93 (20%)
Ig 51..131 CDD:299845 19/98 (19%)
I-set 144..240 CDD:254352 29/104 (28%)
IGc2 159..228 CDD:197706 22/75 (29%)
Ig 244..337 CDD:299845 28/120 (23%)
I-set 244..337 CDD:254352 28/120 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.