DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and Lsamp

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:375 Identity:87/375 - (23%)
Similarity:130/375 - (34%) Gaps:79/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 PKVKVNVMG-SLPGGAGGSVG-GAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDE 299
            |..:||:.. ::||....||. ..|..::.:..|...:      |.|..:...|.|.:   :|..
  Rat    30 PPAEVNLSPITIPGLPVRSVDFNRGTDNITVRQGDTAI------LRCVVEDKNSKVAW---LNRS 85

  Fly   300 PII--GGQKTEMVIRNVTRKFH---------------DAIVKCEVQNSVGKSEDSETLDISYAPS 347
            .||  |..|..:..|....|.|               :....|.||...........|.:...|.
  Rat    86 GIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPK 150

  Fly   348 FRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQH--PSDR-VVGTSTNL-TFSVSNETAGRYYC 408
            .......:..:.||.|:|.|..:..|:|.|.| :|  |..| ..|....| ...::.|.:|:|.|
  Rat   151 ISNISSDVTVNEGSNVTLVCMANGRPEPVITW-RHLTPLGREFEGEEEYLEILGITREQSGKYEC 214

  Fly   409 K-ANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRARHVSW--------T 464
            | ||....|::. ...|.:...|.|...::.....|..|.::|.||:|| |....|        :
  Rat   215 KAANEVSSADVK-QVKVTVNYPPTITESKSNEATTGRQASLKCEASAVP-APDFEWYRDDTRINS 277

  Fly   465 FNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAK--- 526
            .||.||.|..|              :|:|.:.:....|||.|.|...|..|...|.:.|..:   
  Rat   278 ANGLEIKSTEG--------------QSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLP 328

  Fly   527 -----------------KSVSLLMTIVGGISV-VAFLLVLTILVVVYIKC 558
                             |....:..|.|.||: |...|:...|..:..||
  Rat   329 TVPHPIQEIGTTVHFKQKGPGSVRGINGSISLAVPLWLLAASLFCLLSKC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 15/80 (19%)
I-set 346..420 CDD:254352 23/78 (29%)
Ig 360..425 CDD:299845 22/69 (32%)
Ig5_KIRREL3-like 428..524 CDD:143235 27/103 (26%)
IG_like 435..524 CDD:214653 25/96 (26%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 17/98 (17%)
FR1 55..71 CDD:409353 2/21 (10%)
Ig strand A' 56..62 CDD:409353 0/5 (0%)
Ig strand B 64..72 CDD:409353 2/13 (15%)
CDR1 72..76 CDD:409353 0/3 (0%)
FR2 77..84 CDD:409353 2/9 (22%)
Ig strand C 77..83 CDD:409353 2/8 (25%)
CDR2 85..95 CDD:409353 3/9 (33%)
Ig strand C' 87..90 CDD:409353 2/2 (100%)
Ig strand C' 92..95 CDD:409353 0/2 (0%)
FR3 96..131 CDD:409353 4/34 (12%)
Ig strand D 100..107 CDD:409353 2/6 (33%)
Ig strand E 110..116 CDD:409353 0/5 (0%)
Ig strand F 123..131 CDD:409353 1/7 (14%)
CDR3 132..136 CDD:409353 0/3 (0%)
Ig strand G 136..145 CDD:409353 1/8 (13%)
FR4 138..145 CDD:409353 1/6 (17%)
Ig_3 148..218 CDD:404760 20/70 (29%)
Ig strand A' 155..160 CDD:409353 0/4 (0%)
Ig strand B 166..173 CDD:409353 3/6 (50%)
Ig strand C 179..184 CDD:409353 2/5 (40%)
Ig strand D 190..193 CDD:409353 1/2 (50%)
Ig strand E 197..203 CDD:409353 1/5 (20%)
Ig strand F 210..217 CDD:409353 4/6 (67%)
Ig strand G 224..232 CDD:409353 1/8 (13%)
Ig_3 235..311 CDD:404760 24/90 (27%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 2/3 (67%)
Ig strand F 304..309 CDD:409353 2/4 (50%)
Ig strand G 318..321 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.