DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and dpr9

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:367 Identity:71/367 - (19%)
Similarity:118/367 - (32%) Gaps:113/367 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 SLPG-GAGGSVGGA------------GGGSVHMSTGSRIVEH----SQVRLECRA---DANPSDV 290
            :||. |.|||..||            |.||.:.|:|:....|    |....|..|   ||:.|.|
  Fly   144 ALPNEGVGGSAAGAGEAAAPGPTGIDGSGSGNNSSGNNKNGHPAAGSGAASESAALTTDASRSSV 208

  Fly   291 RYRWFINDEPIIGGQKTEMVIRN-----VTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSF-R 349
            .....|...|.....|......|     :...||...:..|...:.|             |.| :
  Fly   209 GGATTITGIPSSSLHKASSASSNTFSSQLASGFHRNSIDLEEARNAG-------------PYFDK 260

  Fly   350 QRPQSMEADVGSVVSLTCEV----DSNPQPEIVWIQHPSDRVVGTSTNLTFS------------- 397
            ...:::.|.:|....|.|.|    :.....::.|::|....:: |....|::             
  Fly   261 AFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLL-TVGRYTYTSDQRFRAIHQPQT 324

  Fly   398 ---------VSNETAGRYYCKANVPGYAEISADAYVYLK---------GSPAIGSQRTQYGLVGD 444
                     ..:..:|.|.|:.:...:    ...|::|.         |:|.:      |...|.
  Fly   325 EDWMLQIKYPQHRDSGIYECQVSTTPH----MSHYIHLNVVEPSTEIIGAPDL------YIESGS 379

  Fly   445 TARIECFASSVPR-ARHVSWTFNGQEISSESGHDYSILVDAVPGGVK----------STLIIRDS 498
            |..:.|...:.|. ..::.|..|    ::...|...|..|:..|||.          |.|:|:.:
  Fly   380 TINLTCIIQNSPEPPAYIFWNHN----NAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSA 440

  Fly   499 QAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGIS 540
            :....|.|.|...|             .|..|:.:.::.|:|
  Fly   441 RPSDSGHYQCNPSN-------------AKPKSVTVHVLNGVS 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 17/75 (23%)
I-set 346..420 CDD:254352 14/100 (14%)
Ig 360..425 CDD:299845 12/90 (13%)
Ig5_KIRREL3-like 428..524 CDD:143235 22/106 (21%)
IG_like 435..524 CDD:214653 20/99 (20%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 14/102 (14%)
IG_like 263..360 CDD:214653 14/101 (14%)
IG_like 371..464 CDD:214653 23/115 (20%)
IGc2 377..456 CDD:197706 19/95 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.