DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and LRIT1

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_056428.1 Gene:LRIT1 / 26103 HGNCID:23404 Length:623 Species:Homo sapiens


Alignment Length:477 Identity:85/477 - (17%)
Similarity:139/477 - (29%) Gaps:190/477 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QCQVSPGPE---GQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEIT 167
            :||   |||   |..:|||...|..:|                        .| ...|.|..|::
Human   250 KCQ---GPELHPGVASIRSLLGGTALL------------------------RC-GATGVPGPEMS 286

  Fly   168 WIDGLG---------NVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQN--TAD 221
            |....|         .|.:|...:|::.||        :|..|      .:.::.|||:|  .|.
Human   287 WRRANGRPLNGTVHQEVSSDGTSWTLLGLP--------AVSHL------DSGDYICQAKNFLGAS 337

  Fly   222 RTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEH-SQVRLECRADA 285
            .|..|.     :...|.......|| ||......|  |||.........:..| .|:........
Human   338 ETVISL-----IVTEPPTSTEHSGS-PGALWARTG--GGGEAAAYNNKLVARHVPQIPKPAVLAT 394

  Fly   286 NPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQ 350
            .||             :...|.|:.:.:..            .:::|:..|...     .||..:
Human   395 GPS-------------VPSTKEELTLEHFQ------------MDALGELSDGRA-----GPSEAR 429

  Fly   351 RPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSNETAGRYYCKANV--P 413
            ..:|::. ||         |:.....:||      :.........|||.....|::..:..:  |
Human   430 MVRSVKV-VG---------DTYHSVSLVW------KAPQAKNTTAFSVLYAVFGQHSMRRVIVQP 478

  Fly   414 GYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFA--SSVPRARHVSWTFNGQEISSESGH 476
            |...:                  |..||:..|..:.|..  ..|||                   
Human   479 GKTRV------------------TITGLLPKTKYVACVCVQGLVPR------------------- 506

  Fly   477 DYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISV 541
                                        |..|.:.:.  |:|.:    |:.:..|:..:|..:::
Human   507 ----------------------------KEQCVIFST--NEVVD----AENTQQLINVVVISVAI 537

  Fly   542 VAFLLVLTILV---VVYIKCKK 560
            | ..|.||:||   .:..:|:|
Human   538 V-IALPLTLLVCCSALQKRCRK 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 10/26 (38%)
Ig 42..114 CDD:299845 3/7 (43%)
C2-set_2 135..225 CDD:285423 19/100 (19%)
Ig_3 265..329 CDD:290638 6/64 (9%)
I-set 346..420 CDD:254352 14/75 (19%)
Ig 360..425 CDD:299845 10/66 (15%)
Ig5_KIRREL3-like 428..524 CDD:143235 12/97 (12%)
IG_like 435..524 CDD:214653 12/90 (13%)
LRIT1NP_056428.1 LRR 1 60..81
leucine-rich repeat 61..84 CDD:275378
LRR_8 63..143 CDD:290566
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..129
LRR_8 131..202 CDD:290566
LRR_4 131..171 CDD:289563
LRR 4 132..153
leucine-rich repeat 133..156 CDD:275378
LRR 5 156..177
leucine-rich repeat 157..180 CDD:275378
leucine-rich repeat 181..205 CDD:275378
TPKR_C2 201..>240 CDD:301599
Ig 267..345 CDD:299845 22/121 (18%)
IG_like 267..345 CDD:214653 22/121 (18%)
FN3 431..498 CDD:214495 16/100 (16%)
LRR 6. /evidence=ECO:0000305 571..594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.