DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and NEGR1

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:328 Identity:76/328 - (23%)
Similarity:117/328 - (35%) Gaps:65/328 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 VEHSQVR------LECRADANPSDVRYRWFINDEPII--GGQK----------------TEMVIR 312
            |::..||      |.|..:...|  :..| :|...||  ||.|                ..:.|:
Human    45 VDNMMVRKGDTAVLRCYLEDGAS--KGAW-LNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQ 106

  Fly   313 NVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEI 377
            ||. ...|....|.||...........|.:...|........|..:.|:.|:|||.....|:|.|
Human   107 NVD-VTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSI 170

  Fly   378 VWIQH--PSDRVVGTSTNL-TFSVSNETAGRYYCKA----NVPGYAEISADAYVYLKGSPAIGSQ 435
            .| :|  ||.:.......| .:.::.:.||.|.|.|    :.|...::.    |.:..:|.|  |
Human   171 SW-RHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVK----VVVNFAPTI--Q 228

  Fly   436 RTQYGLV--GDTARIECFASSVPRARHVSW------TFNGQEISSESGHDYSILVDAVPGGVKST 492
            ..:.|.|  |.:..|.|..:.||... ..|      .||||:         .|::...  ..:|.
Human   229 EIKSGTVTPGRSGLIRCEGAGVPPPA-FEWYKGEKKLFNGQQ---------GIIIQNF--STRSI 281

  Fly   493 LIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTI---LVVV 554
            |.:.:....|:|.|.|...|..|...|.:.|....:....:|....:....:.||||:   ..:.
Human   282 LTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIF 346

  Fly   555 YIK 557
            |:|
Human   347 YLK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 19/80 (24%)
I-set 346..420 CDD:254352 21/80 (26%)
Ig 360..425 CDD:299845 19/71 (27%)
Ig5_KIRREL3-like 428..524 CDD:143235 25/103 (24%)
IG_like 435..524 CDD:214653 23/96 (24%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 20/91 (22%)
IGc2 152..210 CDD:197706 18/58 (31%)
Ig_3 225..301 CDD:372822 22/89 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.