| Sequence 1: | NP_001284835.1 | Gene: | rst / 31290 | FlyBaseID: | FBgn0003285 | Length: | 764 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_499714.1 | Gene: | zig-8 / 176732 | WormBaseID: | WBGene00006985 | Length: | 268 | Species: | Caenorhabditis elegans |
| Alignment Length: | 246 | Identity: | 58/246 - (23%) |
|---|---|---|---|
| Similarity: | 91/246 - (36%) | Gaps: | 57/246 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 349 RQRPQSMEADVGSVVS-----LTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFS------VSNET 402
Fly 403 A---------------GRYYCKANVPGYAEISADAY-----VYLK------GSPAI---GSQRTQ 438
Fly 439 YGLVGDTARIECFASSVPRARH---VSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQA 500
Fly 501 YHYGKYNCTVVNDYGNDVAEI---QLQAKKSVSLLMTIVGGISVVAFLLVL 548 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rst | NP_001284835.1 | IG_like | 34..130 | CDD:214653 | |
| Ig | 42..114 | CDD:299845 | |||
| C2-set_2 | 135..225 | CDD:285423 | |||
| Ig_3 | 265..329 | CDD:290638 | |||
| I-set | 346..420 | CDD:254352 | 23/96 (24%) | ||
| Ig | 360..425 | CDD:299845 | 22/95 (23%) | ||
| Ig5_KIRREL3-like | 428..524 | CDD:143235 | 23/104 (22%) | ||
| IG_like | 435..524 | CDD:214653 | 20/94 (21%) | ||
| zig-8 | NP_499714.1 | IG_like | 55..134 | CDD:214653 | 23/88 (26%) |
| Ig | 55..129 | CDD:143165 | 20/83 (24%) | ||
| ig | 158..229 | CDD:278476 | 19/70 (27%) | ||
| IG_like | 158..227 | CDD:214653 | 18/68 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||