DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and dscam

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_031751619.1 Gene:dscam / 100216449 XenbaseID:XB-GENE-921689 Length:2039 Species:Xenopus tropicalis


Alignment Length:784 Identity:168/784 - (21%)
Similarity:277/784 - (35%) Gaps:192/784 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 TLQWTKDDFGLGTSR---DLSGFERYAMVGSDEEGDYSLDIYPV------MLDDDARYQCQVSPG 112
            ||:|.     |.|..   |:.|.......|       :|.|:|.      .|..|..|.| .:..
 Frog    55 TLRWY-----LATGEEIYDVPGIRHVHHNG-------TLQIFPFPPSSFNNLIHDNTYYC-TAEN 106

  Fly   113 PEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPA--AEITWIDGLGNV 175
            |.|:  |||....:..::  ..|...:.|...|.....|..:|:......|  ..::|       
 Frog   107 PSGK--IRSQDVHIKAVL--REPYTVRVDDQKAMRGNAVVFKCIIPSSVEAYVTVVSW------- 160

  Fly   176 LTDNIEYTVIPLPDQRRF--TAKSVLRLTP-KKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAP 237
                 |...:.|....||  |:...|.:.. :.|....|:.|..::         |...|.:.:.
 Frog   161 -----EKDTVSLVSGSRFLITSTGALYIADVQNEDGLNNYRCTTRH---------KYTGETRQSN 211

  Fly   238 KVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFIND---E 299
            ..::.|  |.|..:..|:  ..|...|.:.....||     |.|:|..:|.. :|||..|:   |
 Frog   212 SARLTV--SDPANSAPSI--IDGFEHHKAMAGERVE-----LPCKASGHPIP-KYRWLKNNVLLE 266

  Fly   300 P-------IIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEA 357
            |       ::|     ::|.| ||........|||.|:.|.:|...:|.:.........|:.:::
 Frog   267 PDSRFQHTVVG-----LLIEN-TRPSDSGSYVCEVWNNYGNAEVIGSLYVKQPLKVNISPRKVKS 325

  Fly   358 DVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSNET----------AGRYYC---- 408
            .|||.:||.|.|.....|::.|.::......|.:..:| .|:.||          :|.|.|    
 Frog   326 SVGSQISLACSVTGTDDPDLSWYRNGEIINAGNNVRIT-GVNRETLIMDGMAKSDSGAYQCFVRR 389

  Fly   409 -KANVPGYAEISADAYVYLKGSPAIGSQRTQYGL-VGDTARIECFASSVPRARHVSWTFNGQEIS 471
             |.:...|.::     |...|:|.|.|..::..: .|:...:.|.....|... ::||.:...|.
 Frog   390 EKMSAQDYVQV-----VLEDGTPKIISAFSEKVVSPGEPVSLMCNVKGTPLPT-ITWTLDDDPII 448

  Fly   472 SESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLL---- 532
            ....|..|.|:.: .|.|.|.|.|.::|....|.|.||..|..|..:.:.::..:...|:.    
 Frog   449 KNGNHRISQLITS-EGNVVSYLNITNTQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKN 512

  Fly   533 MTIVGGISVVAFLLVLTILVVVYIKCK------------KRTKLPPADVISEHQIT-KNGGVSCK 584
            :|.:.|..             .||.|:            |.:.|.|   .:..|:. :|.|    
 Frog   513 ITAIAGRD-------------TYIHCRVIGYPYYSIKWYKNSNLLP---FNHRQVAFENNG---- 557

  Fly   585 LEPGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLTTCSTKSNGSSTIMQNNHQNQ-----L 644
                  |...||::.|     |..|:|..:....||..|:            |:.|...     :
 Frog   558 ------TLKLSDVQKD-----VDEGEYMCNVLVQPQLSTS------------QSVHVTVKVPPFI 599

  Fly   645 QLQQQQQQSHHQH-----HTQTTTLPMTFLTNSSGGSLTGSIIGSREIRQDNGLPSLQSTTASVV 704
            |..:.|:.|..|.     ...:..||:|......|..:..|:    .:..|| :....|...|.:
 Frog   600 QPFESQRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPASL----GVTIDN-IDFTSSLRISNL 659

  Fly   705 SSSPNG--SCSNQSTTAATTTTTHVVVPSSMALSVDPRY-------SAIYGNPYLRSSNSSLLPP 760
            |...||  :|..::..||....:.::|      .|.||:       ..|||...:.:.::...|.
 Frog   660 SLMHNGNYTCIARNDAAAVEHQSQLIV------RVPPRFVVQPTDQDGIYGKAVILNCSAEGYPV 718

  Fly   761 PTAV 764
            ||.|
 Frog   719 PTIV 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 20/81 (25%)
Ig 42..114 CDD:299845 15/65 (23%)
C2-set_2 135..225 CDD:285423 16/94 (17%)
Ig_3 265..329 CDD:290638 20/73 (27%)
I-set 346..420 CDD:254352 20/88 (23%)
Ig 360..425 CDD:299845 18/79 (23%)
Ig5_KIRREL3-like 428..524 CDD:143235 25/96 (26%)
IG_like 435..524 CDD:214653 21/89 (24%)
dscamXP_031751619.1 Ig 26..121 CDD:416386 20/80 (25%)
Ig strand A' 33..37 CDD:409353
Ig strand B 40..49 CDD:409353
Ig strand C 55..61 CDD:409353 3/10 (30%)
Ig strand C' 63..66 CDD:409353 0/2 (0%)
Ig strand D 72..75 CDD:409353 0/2 (0%)
Ig strand E 80..85 CDD:409353 2/4 (50%)
Ig strand F 98..106 CDD:409353 2/8 (25%)
Ig strand G 109..121 CDD:409353 4/13 (31%)
Ig 124..217 CDD:416386 18/113 (16%)
Ig strand A' 127..136 CDD:409353 1/8 (13%)
Ig strand B 140..147 CDD:409353 2/6 (33%)
Ig strand C 157..162 CDD:409353 1/16 (6%)
Ig strand C' 164..167 CDD:409353 0/2 (0%)
Ig strand D 172..176 CDD:409353 2/3 (67%)
Ig strand E 179..185 CDD:409353 1/5 (20%)
Ig strand F 193..201 CDD:409353 2/7 (29%)
Ig strand G 205..217 CDD:409353 1/11 (9%)
Ig strand A 225..228 CDD:409353 1/4 (25%)
Ig strand A' 234..237 CDD:409353 1/2 (50%)
IG_like 236..310 CDD:214653 24/85 (28%)
Ig strand B 242..249 CDD:409353 4/11 (36%)
Ig strand C 255..260 CDD:409353 3/4 (75%)
Ig strand C' 262..264 CDD:409353 0/1 (0%)
Ig strand D 270..274 CDD:409353 0/3 (0%)
Ig strand E 276..280 CDD:409353 1/8 (13%)
Ig strand F 289..297 CDD:409353 3/7 (43%)
Ig strand G 300..310 CDD:409353 3/9 (33%)
Ig 313..395 CDD:416386 19/82 (23%)
Ig strand A 314..319 CDD:409353 0/4 (0%)
Ig strand A' 322..326 CDD:409353 0/3 (0%)
Ig strand B 329..339 CDD:409353 5/9 (56%)
Ig strand C 344..350 CDD:409353 1/5 (20%)
Ig strand C' 351..354 CDD:409353 0/2 (0%)
Ig strand E 368..374 CDD:409353 2/5 (40%)
Ig strand F 381..389 CDD:409353 3/7 (43%)
Ig 406..501 CDD:416386 24/96 (25%)
Ig strand A 406..409 CDD:409353 1/2 (50%)
Ig strand A' 415..419 CDD:409353 0/3 (0%)
Ig strand B 422..431 CDD:409353 1/8 (13%)
Ig strand C 436..442 CDD:409353 1/6 (17%)
Ig strand C' 444..447 CDD:409353 0/2 (0%)
Ig strand D 452..460 CDD:409353 3/7 (43%)
Ig strand E 464..473 CDD:409353 4/8 (50%)
Ig strand F 480..488 CDD:409353 4/7 (57%)
Ig strand G 491..501 CDD:409353 1/9 (11%)
Ig 504..593 CDD:416386 24/131 (18%)
Ig strand A 505..507 CDD:409353 0/1 (0%)
Ig strand A' 512..516 CDD:409353 1/3 (33%)
Ig strand B 519..526 CDD:409353 2/19 (11%)
Ig strand C 533..539 CDD:409353 0/5 (0%)
Ig strand C' 540..542 CDD:409353 0/1 (0%)
Ig strand D 549..553 CDD:409353 1/3 (33%)
Ig strand E 557..563 CDD:409353 2/15 (13%)
Ig strand F 571..579 CDD:409353 2/7 (29%)
Ig strand G 583..593 CDD:409353 3/21 (14%)
Ig 596..686 CDD:416386 19/94 (20%)
Ig strand A 597..599 CDD:409353 0/1 (0%)
Ig strand A' 604..608 CDD:409353 1/3 (33%)
Ig strand B 611..620 CDD:409353 1/8 (13%)
Ig strand C 625..632 CDD:409353 2/6 (33%)
Ig strand C' 634..636 CDD:409353 1/1 (100%)
Ig strand D 643..648 CDD:409353 2/5 (40%)
Ig strand E 651..658 CDD:409353 1/6 (17%)
Ig strand F 665..673 CDD:409353 2/7 (29%)
Ig strand G 676..685 CDD:409353 2/8 (25%)
Ig_DSCAM 689..784 CDD:409397 9/34 (26%)
Ig strand B 707..711 CDD:409397 0/3 (0%)
Ig strand C 720..724 CDD:409397 2/3 (67%)
Ig strand E 749..753 CDD:409397
Ig strand F 763..768 CDD:409397
Ig strand G 777..780 CDD:409397
Ig_DSCAM 785..885 CDD:409398
Ig strand B 805..809 CDD:409398
Ig strand C 818..822 CDD:409398
Ig strand E 849..853 CDD:409398
Ig strand F 863..868 CDD:409398
Ig strand G 876..879 CDD:409398
FN3 886..980 CDD:238020
FN3 987..1084 CDD:238020
FN3 1093..1185 CDD:238020
FN3 1190..1279 CDD:238020
Ig_3 <1303..1364 CDD:404760
Ig strand B 1304..1311 CDD:409353
Ig strand C 1317..1322 CDD:409353
Ig strand C' 1327..1333 CDD:409353
Ig strand D 1337..1341 CDD:409353
Ig strand E 1343..1347 CDD:409353
Ig strand F 1356..1364 CDD:409353
Ig strand G 1367..1377 CDD:409353
FN3 1381..1471 CDD:238020
FN3 1497..1568 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.