DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rst and ncam2

DIOPT Version :9

Sequence 1:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_012811963.1 Gene:ncam2 / 100151722 XenbaseID:XB-GENE-1217730 Length:865 Species:Xenopus tropicalis


Alignment Length:526 Identity:122/526 - (23%)
Similarity:195/526 - (37%) Gaps:118/526 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VGARVTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYS-LDIYPVMLDDDAR 104
            ||......|.||.:...:.|    |.....:.:|| :|..:   ..||..| |.||...:||...
 Frog    63 VGQSKYFTCTVIGEADNIDW----FNPQGEKIISG-QRVVV---QREGIRSWLTIYKANVDDAGI 119

  Fly   105 YQCQVSPGP-EGQPA--IRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEI 166
            |:||.:... ..|.|  :...:..||....|...:..:|:        ..|:.|: |...||..:
 Frog   120 YRCQATDSKGHAQEATVVLEIY
QKLTFEDVPSPQEFKRGE--------NAEVLCL-VSSSPAPMV 175

  Fly   167 TWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADR---TYR--- 225
            .|::...:| ||         .|.|||.      :.|       |.:.|.:|.:.|   .||   
 Frog   176 RWLNNREDV-TD---------IDDRRFA------MLP-------NNNLQIKNISKRDEGIYRCEG 217

  Fly   226 SAKIRVEVKYAP-KVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSD 289
            ..::|.|:.:.. .|.|||...:.         |...|.: :|..|:   ..:.|.|||..:|..
 Frog   218 RVEVRGEIDFRDISVIVNVPPEIL---------AQQRSFN-ATADRL---EDITLFCRATGSPKP 269

  Fly   290 VRYRWFINDEPIIGGQK-------TEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPS 347
            . ..|..|.:.:...:|       ||:.::|:. .....:..|...|..|.:|....|.:...|.
 Frog   270 Y-ITWHRNGKLVEENEKYDLREDNTELTVKNII-STDSGLYVCRATNKAGFTEKQSFLQVFVQPH 332

  Fly   348 FRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVV------------------GTSTNL 394
            ..|.......:.|. |:||||.:..|.|||.| :..||.::                  |.|:..
 Frog   333 IVQLQNETTIEHGH-VTLTCEAEGEPIPEITW-KRSSDGMIFYDGDKSQDGRIESTGHHGKSSLH 395

  Fly   395 TFSVSNETAGRYYCKA--NVPGYAEISADAYVYLKGSPA-IGSQRTQYGLVGDTARIECFASSVP 456
            ..||....||||.|:|  .:.|:.:   ..|:.::.:|. |.:|...|....:...|.|..:|.|
 Frog   396 IKSVMLSDAGRYDCEAASRIGGHQK---SMYLNIEYAPKFISNQTIYYSWENNPINISCDVTSNP 457

  Fly   457 RARHVSWTFNGQEISSESGHDYSIL-------VDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDY 514
            .: .:.|:           .|..:|       :.....|.:..|.|.......:|:||||.:|..
 Frog   458 PS-SIYWS-----------RDKLLLPARNITNIKTYRDGKRILLEITPLSDNDFGRYNCTAINSI 510

  Fly   515 GNDVAE 520
            |:.:.|
 Frog   511 GSRIQE 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 25/92 (27%)
Ig 42..114 CDD:299845 20/73 (27%)
C2-set_2 135..225 CDD:285423 19/92 (21%)
Ig_3 265..329 CDD:290638 14/70 (20%)
I-set 346..420 CDD:254352 26/93 (28%)
Ig 360..425 CDD:299845 25/84 (30%)
Ig5_KIRREL3-like 428..524 CDD:143235 22/101 (22%)
IG_like 435..524 CDD:214653 20/93 (22%)
ncam2XP_012811963.1 Ig 50..141 CDD:386229 23/85 (27%)
IG_like 150..234 CDD:214653 25/115 (22%)
Ig 237..330 CDD:386229 20/107 (19%)
Ig 329..426 CDD:386229 27/101 (27%)
IG_like 442..520 CDD:214653 18/87 (21%)
FN3 525..617 CDD:238020
fn3 623..706 CDD:365830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.