DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and SPS19

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_014197.2 Gene:SPS19 / 855518 SGDID:S000005146 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:249 Identity:73/249 - (29%)
Similarity:119/249 - (47%) Gaps:12/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQET---VQELGSERSAAL---EVDVSS 66
            ||||.|||....|.|.....|...|.|...|.|:.:..::.   :.:|..::.|.|   .|||.:
Yeast    24 GKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANVDVRN 88

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMI 131
            .:.|:.:|.:.::||.:...::..:||.....:....|.. :..|..::|.|:|...:|..|   
Yeast    89 FEQVENAVKKTVEKFGKIDFVIAGAAGNFVCDFANLSPNA-FKSVVDIDLLGSFNTAKACLK--- 149

  Fly   132 EQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTP-- 194
            |.|...|:|:.:|:.........|.:..|.|||:.:..:..:.|.|..|||.|||.||.||..  
Yeast   150 ELKKSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSNCIAPGAIDNTEG 214

  Fly   195 MVAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248
            :..:.....|::.:.:.||.|||...:|||...::.||.:|||.|..:.|.||:
Yeast   215 LKRLAGKKYKEKALAKIPLQRLGSTRDIAESTVYIFSPAASYVTGTVLVVDGGM 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 72/247 (29%)
BKR_SDR_c 9..248 CDD:187594 71/246 (29%)
SPS19NP_014197.2 TER_DECR_SDR_a 22..270 CDD:187627 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.