DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and IRC24

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:64/254 - (25%)
Similarity:107/254 - (42%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLLAR--DGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSV 70
            |||.|:|||..|||....:.:..  |...|..|.|.....|...:|.|:::.....:|::....:
Yeast     2 GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDRSRM 66

  Fly    71 QFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYD-----DVYGVNLKGTFLVTQ--AYAK 128
            :..|.|..:|..:...||.| ||:......:.....::|     .::.||.   |.:..  |...
Yeast    67 EALVEEIRQKHGKLDGIVAN-AGMLEPVKSISQSNSEHDIKQWERLFDVNF---FSIVSLVALCL 127

  Fly   129 AMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFT-EVASKEFGKFGIRVNCILPGYID 192
            .:::.....|.||.:||..:.....|.:.|..:||.:..|. ::||:| ....:|..||.||.:|
Yeast   128 PLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEE-PSDKVRAVCIAPGVVD 191

  Fly   193 TPMVAVVPDSVKQEVVQRCPLGRLGQ---------PEEIAEVIAFL---ASPQSSYVNG 239
            |.|...:.:::..:.:....|.|..|         |:..|.|:|.|   ..|.|  :||
Yeast   192 TQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLKGIPDS--LNG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 64/254 (25%)
BKR_SDR_c 9..248 CDD:187594 63/253 (25%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 62/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.