DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and NRE1

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:48/205 - (23%)
Similarity:90/205 - (43%) Gaps:22/205 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKVALVTGAGSGIGRATCRLL-ARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSVQ 71
            |||.||||...|||::...:| :.|...|:......:|..:.::|...:|...:..|::....::
Yeast     2 GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDSVLK 66

  Fly    72 FSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDV--------YGVNLKGTFLVTQAYAK 128
            ..|..|:|...:..::|.| ||:..       |.::.:::        |.:|.   |.:......
Yeast    67 QLVNAAVKGHGKIDSLVAN-AGVLE-------PVQNVNEIDVNAWKKLYDINF---FSIVSLVGI 120

  Fly   129 AMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDT 193
            |:.|.|..||.:|.:||....|.......|.::||.:..|....:.|  :..::...:.||.:||
Yeast   121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAIAVAPGIVDT 183

  Fly   194 PMVAVVPDSV 203
            .|...:.::|
Yeast   184 DMQVNIRENV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 48/205 (23%)
BKR_SDR_c 9..248 CDD:187594 47/204 (23%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 46/203 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.