DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and CBR4

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_006714454.1 Gene:CBR4 / 84869 HGNCID:25891 Length:247 Species:Homo sapiens


Alignment Length:251 Identity:87/251 - (34%)
Similarity:132/251 - (52%) Gaps:19/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVSSAQSVQFS 73
            ||..|.|...|||||..:|:||.|.::..:.|||:.|:....:||.:. .|...||:....|| :
Human     3 KVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDH-LAFSCDVAKEHDVQ-N 65

  Fly    74 VAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLENG 138
            ..|.|:|.......:||:|||.|||.|::....|.......||.|:.|..:|..:.||:|  :.|
Human    66 TFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQ--QGG 128

  Fly   139 TIVNLS----------SIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDT 193
            :|||:.          |||....|.||:.|:|:|.|::.|:...:||..:..||||.:.||::.|
Human   129 SIVNVGHRREMLLHKRSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHT 193

  Fly   194 PMVAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGLK 249
            .|   ..|..::.:.:..||||.|:..|:|..:.||.  :|.|:.|..:.|.|||:
Human   194 DM---TKDLKEEHLKKNIPLGRFGETIEVAHAVVFLL--ESPYITGHVLVVDGGLQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 85/248 (34%)
BKR_SDR_c 9..248 CDD:187594 85/248 (34%)
CBR4XP_006714454.1 NADB_Rossmann 3..243 CDD:304358 85/248 (34%)
3oxo_ACP_reduc 7..243 CDD:273824 83/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100272
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.