DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and ABA2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_175644.1 Gene:ABA2 / 841665 AraportID:AT1G52340 Length:285 Species:Arabidopsis thaliana


Alignment Length:263 Identity:81/263 - (30%)
Similarity:127/263 - (48%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQEL--GSERSAALEV--DVSS 66
            |.|||||:||..:|||.:..||..:.||||..||.......|..:.|  |..:..|..:  ||..
plant    18 LLGKVALITGGATGIGESIVRLFHKHGAKVCIVDLQDDLGGEVCKSLLRGESKETAFFIHGDVRV 82

  Fly    67 AQSVQFSVAEALKKFQQAPTIVVNSAGITR------DGYLLKMPERDYDDVYGVNLKGTFLVTQA 125
            ...:..:|..|:|.|... .|::|:||:..      ..|.|.    :::..:.||:||.||..:.
plant    83 EDDISNAVDFAVKNFGTL-DILINNAGLCGAPCPDIRNYSLS----EFEMTFDVNVKGAFLSMKH 142

  Fly   126 YAKAMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGY 190
            .|:.||.:|  .|:||:|.|:...:..||..:|..:|..|:..|...:.|.|:.||||||:.|..
plant   143 AARVMIPEK--KGSIVSLCSVGGVVGGVGPHSYVGSKHAVLGLTRSVAAELGQHGIRVNCVSPYA 205

  Fly   191 IDTPM-VAVVPDSVKQE---------VVQRCPL-GRLGQPEEIAEVIAFLASPQSSYVNGAAIEV 244
            :.|.: :|.:|:..:.|         ......| |.....:::|..:.||||..|.|::|..:.:
plant   206 VATKLALAHLPEEERTEDAFVGFRNFAAANANLKGVELTVDDVANAVLFLASDDSRYISGDNLMI 270

  Fly   245 TGG 247
            .||
plant   271 DGG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 81/263 (31%)
BKR_SDR_c 9..248 CDD:187594 79/260 (30%)
ABA2NP_175644.1 PLN02253 3..285 CDD:177895 81/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.