DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and AT1G24360

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_564216.1 Gene:AT1G24360 / 839053 AraportID:AT1G24360 Length:319 Species:Arabidopsis thaliana


Alignment Length:243 Identity:98/243 - (40%)
Similarity:150/243 - (61%) Gaps:7/243 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALVTGAGSGIGRATCRLLARDGAKVIA-VDRNLKAAQETVQELGSERSAALEV--DVSSAQSVQ 71
            |.::|||..|||:|....|.:.|.||:. ..|:.|.|:|..:::......|:..  |||.|..|.
plant    78 VVVITGASRGIGKAIALALGKAGCKVLVNYARSAKEAEEVAKQIEEYGGQAITFGGDVSKATDVD 142

  Fly    72 FSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLE 136
            ..:..||.|:... .:|||:||||||..|::|.:..:|:|..:||.|.||.|||..|.|:::|  
plant   143 AMMKTALDKWGTI-DVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQAAVKIMMKKK-- 204

  Fly   137 NGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAVVPD 201
            .|.|:|:||:|..:.|:|||||||.|.|||||::.|::|.....|.||.:.||:|.:.|.|.:.:
plant   205 RGRIINISSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDMTAELGE 269

  Fly   202 SVKQEVVQRCPLGRLGQPEEIAEVIAFLA-SPQSSYVNGAAIEVTGGL 248
            .::::::...||||.|:.||:|.::.||| ||.:||:.|.|..:.||:
plant   270 DMEKKILGTIPLGRYGKAEEVAGLVEFLALSPAASYITGQAFTIDGGI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 97/241 (40%)
BKR_SDR_c 9..248 CDD:187594 97/241 (40%)
AT1G24360NP_564216.1 3oxo_ACP_reduc 79..318 CDD:273824 97/242 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 167 1.000 Domainoid score I1187
eggNOG 1 0.900 - - E2759_KOG1200
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1520
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - oto4191
orthoMCL 1 0.900 - - OOG6_100272
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.