DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and AT5G18210

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_197322.2 Gene:AT5G18210 / 831939 AraportID:AT5G18210 Length:277 Species:Arabidopsis thaliana


Alignment Length:247 Identity:85/247 - (34%)
Similarity:128/247 - (51%) Gaps:25/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIA--VDRNLKAAQETVQELGSERSAALE--- 61
            ||..|||:||:|||:..|||||....||..|||::.  ..|:.:|.| ...|:.|......:   
plant     4 SVSSLAGRVAIVTGSSRGIGRAIAIHLAELGAKIVINYTTRSTEADQ-VAAEINSSAGTVPQPIA 67

  Fly    62 ----VDVSSAQSVQ--FSVAEALKKFQQAPTIVVNSAGITRDGY--LLKMPERDYDDVYGVNLKG 118
                .|:|....::  |..||  |.|.....|:||||||....|  :...|..::|.::.||.:|
plant    68 VVFLADISEPSQIKSLFDAAE--KAFNSPVHILVNSAGILNPNYPTIANTPIEEFDRIFKVNTRG 130

  Fly   119 TFLVTQAYAKAMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRV 183
            :||..:..||.:  ::...|.|:.|:|.:.:....||..|.|:||.|.:..::.:||....||..
plant   131 SFLCCKEAAKRL--KRGGGGRIILLTSSLTEALIPGQGAYTASKAAVEAMVKILAKELKGLGITA 193

  Fly   184 NCILPGYIDTPMVAVVPDSVKQE----VVQRCPLGRLGQPEEIAEVIAFLAS 231
            ||:.||.:.|.|..   |...:|    :::|.|.||||:.::||.|:.||||
plant   194 NCVSPGPVATEMFF---DGKSEETVMNIIERSPFGRLGETKDIASVVGFLAS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 83/243 (34%)
BKR_SDR_c 9..248 CDD:187594 80/240 (33%)
AT5G18210NP_197322.2 fabG 7..245 CDD:235500 83/244 (34%)
NADB_Rossmann 8..245 CDD:304358 83/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.