DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and AT3G55310

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_191091.2 Gene:AT3G55310 / 824697 AraportID:AT3G55310 Length:279 Species:Arabidopsis thaliana


Alignment Length:253 Identity:83/253 - (32%)
Similarity:132/253 - (52%) Gaps:13/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERS-----AALEVDVS 65
            |..||.|||||.|||||..|..||:.|.:|||..|.:........|:.|..|     ||||:|||
plant    17 LKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVS 81

  Fly    66 S-AQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYL-LKMPERDYDDVYGVNLKGTFLVTQAYAK 128
            | |.::|.:|.||...|.:...: :|:|||..:..| |.:.|.::|:|:..||||.:||.: |..
plant    82 SDAATIQKAVREAWDIFGKIDAL-INNAGIRGNVKLSLDLSEDEWDNVFNTNLKGPWLVAK-YVC 144

  Fly   129 AMIEQKLENGTIVNLSSIVAKMNNV-GQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYID 192
            .::......|:::|:||:....:.| |...|:.:|.||.:.:.:.:.|.|...||||.|.||...
plant   145 VLMRDAKRGGSVINISSVAGVRSIVPGGLAYSCSKGGVDTMSRMMAIELGVHKIRVNSIAPGLFK 209

  Fly   193 TPMV-AVVPDSVKQEVVQRCPLGRLGQPEE--IAEVIAFLASPQSSYVNGAAIEVTGG 247
            :.:. |::.....:.|.:|....::.|..:  :..::.:|....|.|::|....|..|
plant   210 SEITQALMQKEWLKNVTERTVPLKVQQTIDPGLTSLVRYLIHDSSQYISGNTYIVDSG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 83/253 (33%)
BKR_SDR_c 9..248 CDD:187594 82/250 (33%)
AT3G55310NP_191091.2 SDR_c 22..265 CDD:212491 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.