DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and AT3G55290

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_567019.1 Gene:AT3G55290 / 824695 AraportID:AT3G55290 Length:280 Species:Arabidopsis thaliana


Alignment Length:266 Identity:86/266 - (32%)
Similarity:127/266 - (47%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERS-----AALEVDVS 65
            |..||.|||||.|||||..|..||:.|.:|||..|.:........|:.|..|     ||||:|||
plant    18 LKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVS 82

  Fly    66 S-AQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYL---LKMPERDYDDVYGVNLKGTFLVTQAY 126
            | |.::|.:|.||...|.:...: :|:|||.  |.:   |.:.|.::|:|:..||||.:||::..
plant    83 SDAATIQKAVREAWDIFGKIDAL-INNAGIR--GNVKSSLDLSEDEWDNVFKTNLKGPWLVSKHV 144

  Fly   127 AKAMIEQKLENGTIVNLSSIVAKMNNV-GQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGY 190
            ...|.:.| ..|:::|:|||......: |...||.:|.||.:.:.:.:.|.|...||||.|.||.
plant   145 CMLMRDAK-RGGSVINISSIAGIRGMLPGGLAYACSKGGVDTMSRMMALELGVHKIRVNSIAPGL 208

  Fly   191 IDTPMV--------------AVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAA 241
            ..:.:.              ..||..|:|.|           ...:..::.:|....|.|::|..
plant   209 FKSEITQGLMQKEWLKNVTERTVPLKVQQTV-----------DPGLTSLVRYLIHDSSQYISGNT 262

  Fly   242 IEVTGG 247
            ..|..|
plant   263 YIVDSG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 86/266 (32%)
BKR_SDR_c 9..248 CDD:187594 85/263 (32%)
AT3G55290NP_567019.1 fabG 18..271 CDD:235546 86/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.