DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and AT3G46170

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_190203.1 Gene:AT3G46170 / 823760 AraportID:AT3G46170 Length:288 Species:Arabidopsis thaliana


Alignment Length:265 Identity:85/265 - (32%)
Similarity:133/265 - (50%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERS-----AALEVDVS 65
            |..||.|||||.|||||..|..|.:.|.|:|||.|.:........|:.|..|     |||::||:
plant    26 LKDKVVLVTGASSGIGREICLDLGKAGCKIIAVARRVDRLNSLCSEINSSSSTGIQAAALKLDVT 90

  Fly    66 S-AQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYL---LKMPERDYDDVYGVNLKGTFLVTQAY 126
            | |.::|..|..|...|.:...: :|:|||.  |.:   |.:.:.::|:|:..||.|.:||::..
plant    91 SDAATIQKVVQGAWGIFGKIDAL-INNAGIR--GNVKSSLDLSKEEWDNVFKTNLTGPWLVSKYV 152

  Fly   127 AKAMIEQKLENGTIVNLSSIVAKMNNV--GQANYAATKAGVISFTEVASKEFGKFGIRVNCILPG 189
            ...|.:.|| .|:::|:||| |.:..:  |...||.:|.||.:.:::.:.|.|...||||.|.||
plant   153 CVLMRDAKL-GGSVINISSI-AGIRGILPGALAYACSKIGVDTMSKMMAVELGVHKIRVNSIAPG 215

  Fly   190 YIDTPMVAVVPDSVKQEVVQR----------CPLGRLGQPEE--IAEVIAFLASPQSSYVNGAAI 242
                    :....:.|.::|:          .|| :|.|..:  |..::.:|....|.|::|...
plant   216 --------IFKSEITQGLMQKEWFKNVTERTVPL-KLQQTVDPGITSLVRYLIHDSSQYISGNTY 271

  Fly   243 EVTGG 247
            .|..|
plant   272 IVDSG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 85/265 (32%)
BKR_SDR_c 9..248 CDD:187594 84/262 (32%)
AT3G46170NP_190203.1 SDR_c 31..274 CDD:212491 80/256 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.