DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and AT3G29260

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_189571.1 Gene:AT3G29260 / 822582 AraportID:AT3G29260 Length:259 Species:Arabidopsis thaliana


Alignment Length:252 Identity:69/252 - (27%)
Similarity:121/252 - (48%) Gaps:7/252 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEVDVS 65
            ||...|.||:.::||..||||....||....||||:.||...:..|.....:|.::::....|::
plant     1 MSGQRLDGKIVIITGGASGIGAEAARLFTDHGAKVVIVDLQEELGQNVAVSIGLDKASFYRCDIT 65

  Fly    66 SAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAM 130
            ....|:.:|...::|..:...:..|:..:...|.:|.:....:|....||::|.....:..|::|
plant    66 DETEVENAVKFTVEKHGKLDVLFSNAGVMEPHGSILDLDLEAFDRTMAVNVRGAAAFIKHAARSM 130

  Fly   131 IEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPM 195
            :... ..|:||..:|:.|::...|..:|.|:|..::.....|....||:|||||.:.|..:.|.:
plant   131 VASG-TRGSIVCTTSVTAEIGGPGPHSYTASKHALLGLVRSACGGLGKYGIRVNGVAPYGVATGL 194

  Fly   196 VAVVPDSVKQEVVQRCPL-----GRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            .:...::||. |...|..     |.:.:...:|:...||||..|.|::|..:.|.||
plant   195 TSYNEETVKM-VEDYCSATAILKGVVLKARHVADAALFLASDDSVYISGQNLGVDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 67/247 (27%)
BKR_SDR_c 9..248 CDD:187594 65/244 (27%)
AT3G29260NP_189571.1 PLN02253 1..254 CDD:177895 69/252 (27%)
NADB_Rossmann 5..252 CDD:304358 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.