DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and AT3G26770

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_566798.1 Gene:AT3G26770 / 822290 AraportID:AT3G26770 Length:306 Species:Arabidopsis thaliana


Alignment Length:262 Identity:76/262 - (29%)
Similarity:126/262 - (48%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSER-----SAALEVDVS 65
            |.|||||:||..||:|:||.....|.||:|:..|.:.:...:|.:|||||.     ...:|.|::
plant    41 LEGKVALITGGASGLGKATASEFLRHGARVVIADLDAETGTKTAKELGSEAEFVRCDVTVEADIA 105

  Fly    66 SAQSVQFSVAEALKKFQQAPTIVVNSAGIT---RDGYLLKMPERDYDDVYGVNLKGTFLVTQAYA 127
            .|  |:.:| |...|..    ::.|:|||.   ....:.::...:::.|..:|:.|.....:..|
plant   106 GA--VEMTV-ERYGKLD----VMYNNAGIVGPMTPASISQLDMTEFERVMRINVFGVVSGIKHAA 163

  Fly   128 KAMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYID 192
            |.||..:  :|.|:..||:......:...:|..:|.......:.|:.|..:.|:|:|||.||.:.
plant   164 KFMIPAR--SGCILCTSSVAGVTGGLAPHSYTISKFTTPGIVKSAASELCEHGVRINCISPGTVA 226

  Fly   193 TPMV-----AVVPDSVKQEVVQRC--PLGRLGQPE----EIAEVIAFLASPQSSYVNGAAIEVTG 246
            ||:.     .|.| .|.:|.::..  .:|.|...|    ::|:...:|||....||.|..:.|.|
plant   227 TPLTLSYLQKVFP-KVSEEKLRETVKGMGELKGAECEEADVAKAALYLASNDGKYVTGHNLVVDG 290

  Fly   247 GL 248
            |:
plant   291 GM 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 75/260 (29%)
BKR_SDR_c 9..248 CDD:187594 73/257 (28%)
AT3G26770NP_566798.1 PLN02253 38..294 CDD:177895 76/262 (29%)
NADB_Rossmann 40..293 CDD:304358 76/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.