DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and AT3G26760

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_189311.2 Gene:AT3G26760 / 822289 AraportID:AT3G26760 Length:300 Species:Arabidopsis thaliana


Alignment Length:265 Identity:82/265 - (30%)
Similarity:132/265 - (49%) Gaps:35/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAA--LEVDVSSAQ 68
            |.||||::||..||||:||.......||:||.||.:.:|......|||   |||  |..||:..:
plant    36 LEGKVAVITGGASGIGKATAEEFVSQGAQVIIVDIDEEAGHMVATELG---SAAHFLRCDVTEEE 97

  Fly    69 SVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERD---YDDVYGVNLKGTFLVTQAYAKAM 130
            .:..:|..|:.:..:. .:::|||||:.......:.:.|   ||.|..:|::||.|..:..|:||
plant    98 QIAKAVETAVTRHGKL-DVMLNSAGISCSISPPSIADLDMDTYDKVMRLNVRGTVLGIKHAARAM 161

  Fly   131 IEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPM 195
            |  ...:|:|:.||||...|..:|...|:.:|..:....:..:.|..|.|:|:|||.|..|.||:
plant   162 I--PAGSGSILCLSSISGLMGGLGPHAYSISKFTIPGVVKTVASELCKHGLRINCISPAGIPTPL 224

  Fly   196 V------AVVPDSVKQEVV------------QRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAI 242
            .      |....|:::|.:            ::|      :..::|:...:|||..:.:|.|..:
plant   225 TLRMFREAFAGHSIREEQLLAIVNATGELKGEKC------EEIDVAKAALYLASDDAKFVTGHNL 283

  Fly   243 EVTGG 247
            .|.||
plant   284 VVDGG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 82/265 (31%)
BKR_SDR_c 9..248 CDD:187594 80/262 (31%)
AT3G26760NP_189311.2 PLN02253 30..291 CDD:177895 82/265 (31%)
NADB_Rossmann 35..290 CDD:304358 82/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.