DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and AT2G29340

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_565680.2 Gene:AT2G29340 / 817483 AraportID:AT2G29340 Length:307 Species:Arabidopsis thaliana


Alignment Length:253 Identity:78/253 - (30%)
Similarity:127/253 - (50%) Gaps:18/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQE---LGSERSAALEVDVSSA 67
            |.|..|||||..||||.|....||..||::...|.:.....:::.|   .|.:.|.:: .||:|.
plant     7 LKGMTALVTGGASGIGYAIVEELAGFGARIHVCDISEAKLNQSLSEWEKKGFQVSGSV-CDVASR 70

  Fly    68 QSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDY-DDVYGVNLKGTFLVTQAYAKAMI 131
            ...:..:.....:|.....|:|::.|:.|     ..|..:| :|.:..::...  |..||..:.:
plant    71 PEREELMQTVSSQFDGKLNILVSNVGVIR-----SKPTTEYTEDDFAFHISSN--VEAAYHFSQL 128

  Fly   132 EQKLEN----GTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYID 192
            ...|..    |:|:.:|||...::....:.|..||..:|...:..:.|:.|.|||.|.:.|..|:
plant   129 SHPLLKASGYGSIIFVSSIAGVISFDAGSIYGLTKGALIQLAKNLACEWAKDGIRANAVAPNVIN 193

  Fly   193 TPM-VAVVPD-SVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248
            ||: .:.:.| |.|:.::.|.||||:|:|.|:|.::|||..|.:||:.|..|.|.|||
plant   194 TPLSQSYLEDVSFKKALLSRTPLGRVGEPNEVASLVAFLCLPAASYITGQTICVDGGL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 76/251 (30%)
BKR_SDR_c 9..248 CDD:187594 74/248 (30%)
AT2G29340NP_565680.2 PRK09242 1..256 CDD:181721 78/253 (31%)
NADB_Rossmann 4..254 CDD:304358 78/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.