DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and Bdh2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001165526.1 Gene:Bdh2 / 69772 MGIID:1917022 Length:255 Species:Mus musculus


Alignment Length:255 Identity:90/255 - (35%)
Similarity:142/255 - (55%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALEV-DVS 65
            ::|.|.|||.::|.|..|||||:....||:||||||.|.|    :..:|||.|.|.....| ||:
Mouse    10 TMGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIATDIN----ESKLQELESYRGIQTRVLDVT 70

  Fly    66 SAQSV-QFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKA 129
            ..:.: ||  |..:::..    ::.|.||....|.:|...|:|:|....:|::..||:.:|:...
Mouse    71 KKRQIDQF--ASEIERID----VLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPK 129

  Fly   130 MIEQKLENGTIVNLSSIVAKMNNV-GQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDT 193
            |:.||  :|.|:|:||:.:.:..| .:..|:||||.||..|:..:.:|.:.|||.||:.||.:||
Mouse   130 MLAQK--SGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDT 192

  Fly   194 PMV---AVVPDSVKQEV---VQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247
            |.:   ....|:.|:.:   :.|...||....||:|.:..:|||.:|:||.|..:.:.||
Mouse   193 PSLQERIQARDNPKEALKTFLNRQKTGRFASAEEVALLCVYLASDESAYVTGNPVIIDGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 89/251 (35%)
BKR_SDR_c 9..248 CDD:187594 87/248 (35%)
Bdh2NP_001165526.1 PRK06138 12..254 CDD:235712 90/253 (36%)
DHRS6_like_SDR_c 15..255 CDD:187626 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.