DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3603 and BDH2

DIOPT Version :9

Sequence 1:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_006714337.1 Gene:BDH2 / 56898 HGNCID:32389 Length:259 Species:Homo sapiens


Alignment Length:270 Identity:85/270 - (31%)
Similarity:141/270 - (52%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALE---VDV 64
            :|.|.|||.::|.|..|||:|.....||:||||||.|.|    :..:|||  |:...::   :||
Human     1 MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDIN----ESKLQEL--EKYPGIQTRVLDV 59

  Fly    65 SSAQSV-QFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAK 128
            :..:.: ||  |..:::..    ::.|.||....|.:|...|:|:|....:|::..:|:.:|:..
Human    60 TKKKQIDQF--ANEVERLD----VLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLP 118

  Fly   129 AMIEQKLENGTIVNLSSIVAK---------------MNNVGQANYAATKAGVISFTEVASKEFGK 178
            .|:.||  :|.|:|:||:.:.               :..|.:..|:.|||.||..|:..:.:|.:
Human   119 KMLAQK--SGNIINMSSVASSVKVMATDDEKLRLPMLRVVNRCVYSTTKAAVIGLTKSVAADFIQ 181

  Fly   179 FGIRVNCILPGYIDTPMVAV------VPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYV 237
            .|||.||:.||.:|||.:..      .|:..:.:.::|...||....||||.:..:|||.:|:||
Human   182 QGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYV 246

  Fly   238 NGAAIEVTGG 247
            .|..:.:.||
Human   247 TGNPVIIDGG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3603NP_001259199.1 fabG 6..248 CDD:235546 84/267 (31%)
BKR_SDR_c 9..248 CDD:187594 82/264 (31%)
BDH2XP_006714337.1 DHRS6_like_SDR_c 5..259 CDD:187626 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226147at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.